Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 315647..316045 | Replicon | chromosome |
Accession | NZ_CP119159 | ||
Organism | Enterococcus faecalis strain GENOMIC22-006 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q82Z30 |
Locus tag | P0D81_RS01620 | Protein ID | WP_002387585.1 |
Coordinates | 315647..315790 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 315901..316045 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0D81_RS01615 | 312398..315457 | + | 3060 | WP_002387586.1 | WxL domain-containing protein | - |
P0D81_RS01620 | 315647..315790 | - | 144 | WP_002387585.1 | putative holin-like toxin | Toxin |
- | 315901..316045 | + | 145 | - | - | Antitoxin |
P0D81_RS01625 | 316386..320144 | + | 3759 | WP_010706868.1 | WxL domain-containing protein | - |
P0D81_RS01630 | 320334..320438 | - | 105 | WP_021164545.1 | putative holin-like toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5244.37 Da Isoelectric Point: 10.5719
>T273847 WP_002387585.1 NZ_CP119159:c315790-315647 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILKVVKEDKKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILKVVKEDKKK
Download Length: 144 bp
Antitoxin
Download Length: 145 bp
>AT273847 NZ_CP119159:315901-316045 [Enterococcus faecalis]
TTGTGCTATAATAGCAATGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCTTT
TTAGTTACAAAAAATAACCGTACTCAGTCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAAGC
TTGTGCTATAATAGCAATGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCTTT
TTAGTTACAAAAAATAACCGTACTCAGTCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAAGC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|