Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4522366..4523066 | Replicon | chromosome |
Accession | NZ_CP119143 | ||
Organism | Streptomyces sp. VNUA24 |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | - |
Locus tag | PYR72_RS19045 | Protein ID | WP_275456450.1 |
Coordinates | 4522366..4522752 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PYR72_RS19050 | Protein ID | WP_275456451.1 |
Coordinates | 4522749..4523066 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYR72_RS19020 (PYR72_19020) | 4517692..4519446 | + | 1755 | WP_275456447.1 | succinate dehydrogenase flavoprotein subunit | - |
PYR72_RS19025 (PYR72_19025) | 4519446..4520207 | + | 762 | WP_013001271.1 | succinate dehydrogenase iron-sulfur subunit | - |
PYR72_RS19030 (PYR72_19030) | 4520409..4520672 | - | 264 | WP_013001272.1 | TM2 domain-containing protein | - |
PYR72_RS19035 (PYR72_19035) | 4521010..4521408 | - | 399 | WP_275456448.1 | DUF2752 domain-containing protein | - |
PYR72_RS19040 (PYR72_19040) | 4521401..4521895 | - | 495 | WP_275456449.1 | TM2 domain-containing protein | - |
PYR72_RS19045 (PYR72_19045) | 4522366..4522752 | + | 387 | WP_275456450.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PYR72_RS19050 (PYR72_19050) | 4522749..4523066 | + | 318 | WP_275456451.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PYR72_RS19055 (PYR72_19055) | 4523154..4523939 | + | 786 | WP_275456452.1 | hypothetical protein | - |
PYR72_RS19060 (PYR72_19060) | 4524302..4524538 | - | 237 | WP_275456453.1 | hypothetical protein | - |
PYR72_RS19065 (PYR72_19065) | 4525101..4525529 | - | 429 | WP_275456454.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14897.96 Da Isoelectric Point: 8.6697
>T273837 WP_275456450.1 NZ_CP119143:4522366-4522752 [Streptomyces sp. VNUA24]
MTWHLEMTGDVRDWLHRLRKDDRVSARLVGQAIQALVEEGPDLGRPLVDRIKGSALHHLKELRPGSTGDSEIRILFAFDP
ERSAVLLVAGDKAGRWTAWYRHAMPLAEERYTEWLDHLARRRHKETER
MTWHLEMTGDVRDWLHRLRKDDRVSARLVGQAIQALVEEGPDLGRPLVDRIKGSALHHLKELRPGSTGDSEIRILFAFDP
ERSAVLLVAGDKAGRWTAWYRHAMPLAEERYTEWLDHLARRRHKETER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|