Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4484304..4485058 | Replicon | chromosome |
| Accession | NZ_CP119137 | ||
| Organism | Salmonella enterica subsp. enterica serovar Goldcoast isolate Sal02792 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Z1E8E0 |
| Locus tag | P0D85_RS22630 | Protein ID | WP_000558163.1 |
| Coordinates | 4484304..4484615 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P0D85_RS22635 | Protein ID | WP_001259009.1 |
| Coordinates | 4484612..4485058 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0D85_RS22600 (4479962) | 4479962..4480864 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| P0D85_RS22605 (4480861) | 4480861..4481496 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P0D85_RS22610 (4481493) | 4481493..4482422 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| P0D85_RS22615 (4482469) | 4482469..4482759 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| P0D85_RS22620 (4482760) | 4482760..4483071 | - | 312 | WP_023138876.1 | hypothetical protein | - |
| P0D85_RS22625 (4483289) | 4483289..4484218 | + | 930 | WP_126524392.1 | alpha/beta hydrolase | - |
| P0D85_RS22630 (4484304) | 4484304..4484615 | + | 312 | WP_000558163.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| P0D85_RS22635 (4484612) | 4484612..4485058 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| P0D85_RS22640 (4485073) | 4485073..4486014 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P0D85_RS22645 (4486059) | 4486059..4486496 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| P0D85_RS22650 (4486493) | 4486493..4487365 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P0D85_RS22655 (4487359) | 4487359..4487958 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| P0D85_RS22660 (4488149) | 4488149..4488952 | - | 804 | WP_021000967.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P0D85_RS22665 (4488986) | 4488986..4489882 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12406.36 Da Isoelectric Point: 9.5921
>T273831 WP_000558163.1 NZ_CP119137:4484304-4484615 [Salmonella enterica subsp. enterica serovar Goldcoast]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT273831 WP_001259009.1 NZ_CP119137:4484612-4485058 [Salmonella enterica subsp. enterica serovar Goldcoast]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|