Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 26209..26463 | Replicon | plasmid pCFSAN126949_02 |
| Accession | NZ_CP119123 | ||
| Organism | Escherichia coli strain GENOMIC22-004 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PYZ88_RS24925 | Protein ID | WP_001312851.1 |
| Coordinates | 26314..26463 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 26209..26270 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYZ88_RS24890 (21861) | 21861..22073 | + | 213 | WP_005012601.1 | hypothetical protein | - |
| PYZ88_RS24895 (22374) | 22374..22463 | - | 90 | Protein_31 | IS1 family transposase | - |
| PYZ88_RS24900 (22518) | 22518..23195 | + | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| PYZ88_RS24905 (23195) | 23195..23542 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PYZ88_RS24910 (23562) | 23562..25133 | + | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| PYZ88_RS24915 (25171) | 25171..25787 | - | 617 | Protein_35 | IS1-like element IS1A family transposase | - |
| PYZ88_RS24920 (25888) | 25888..26070 | + | 183 | WP_000968309.1 | hypothetical protein | - |
| - (26209) | 26209..26270 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (26209) | 26209..26270 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (26209) | 26209..26270 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (26209) | 26209..26270 | - | 62 | NuclAT_0 | - | Antitoxin |
| PYZ88_RS24925 (26314) | 26314..26463 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| PYZ88_RS24930 (26747) | 26747..27004 | + | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| PYZ88_RS24935 (27240) | 27240..27314 | + | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| PYZ88_RS24940 (27307) | 27307..27753 | + | 447 | Protein_40 | plasmid replication initiator RepA | - |
| PYZ88_RS24945 (27753) | 27753..28367 | - | 615 | Protein_41 | VENN motif pre-toxin domain-containing protein | - |
| PYZ88_RS24950 (29074) | 29074..30294 | + | 1221 | WP_000410951.1 | arginine deiminase | - |
| PYZ88_RS24955 (30305) | 30305..31216 | + | 912 | WP_000440183.1 | carbamate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sitABCD | iucA / iucB / iucC / iucD / iutA | 1..83235 | 83235 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T273800 WP_001312851.1 NZ_CP119123:26314-26463 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT273800 NZ_CP119123:c26270-26209 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
