Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 109255..109912 Replicon plasmid pCFSAN126949_01
Accession NZ_CP119121
Organism Escherichia coli strain GENOMIC22-004

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag PYZ88_RS24275 Protein ID WP_000270043.1
Coordinates 109255..109605 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PYZ88_RS24280 Protein ID WP_000124640.1
Coordinates 109610..109912 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYZ88_RS24240 (PYZ88_24205) 105729..106226 - 498 WP_000062185.1 hypothetical protein -
PYZ88_RS24245 (PYZ88_24210) 106229..106717 - 489 WP_001273096.1 DUF1643 domain-containing protein -
PYZ88_RS24250 (PYZ88_24215) 106814..107149 + 336 WP_000683477.1 hypothetical protein -
PYZ88_RS24255 (PYZ88_24220) 107164..107634 - 471 WP_001281821.1 hypothetical protein -
PYZ88_RS24260 (PYZ88_24225) 107627..107998 - 372 WP_000516918.1 hypothetical protein -
PYZ88_RS24265 (PYZ88_24230) 108009..108203 - 195 WP_000343597.1 hypothetical protein -
PYZ88_RS24270 (PYZ88_24235) 108544..109092 - 549 WP_001061573.1 hypothetical protein -
PYZ88_RS24275 (PYZ88_24240) 109255..109605 + 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PYZ88_RS24280 (PYZ88_24245) 109610..109912 + 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
PYZ88_RS24285 (PYZ88_24250) 109939..110232 - 294 WP_001239998.1 hypothetical protein -
PYZ88_RS24290 (PYZ88_24255) 110321..110593 - 273 WP_001043046.1 HU family DNA-binding protein -
PYZ88_RS24295 (PYZ88_24260) 110651..111178 - 528 WP_004201083.1 thermonuclease family protein -
PYZ88_RS24300 (PYZ88_24265) 111181..111372 - 192 WP_001270409.1 hypothetical protein -
PYZ88_RS24305 (PYZ88_24270) 111398..112255 - 858 WP_001167036.1 hypothetical protein -
PYZ88_RS24310 (PYZ88_24275) 112242..112472 - 231 WP_000972665.1 hypothetical protein -
PYZ88_RS24315 (PYZ88_24280) 112472..112990 - 519 WP_000210757.1 nitrite reductase -
PYZ88_RS24320 (PYZ88_24285) 112987..113433 - 447 WP_000919343.1 hypothetical protein -
PYZ88_RS24325 (PYZ88_24290) 113433..113792 - 360 WP_000422769.1 hypothetical protein -
PYZ88_RS24330 (PYZ88_24295) 113850..114278 - 429 WP_000591076.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaNDM-1 / rmtC / sul1 / qacE / aac(6')-Ib / blaCMY-6 htpB 1..124387 124387


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T273798 WP_000270043.1 NZ_CP119121:109255-109605 [Escherichia coli]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT273798 WP_000124640.1 NZ_CP119121:109610-109912 [Escherichia coli]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References