Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4137489..4138288 | Replicon | chromosome |
Accession | NZ_CP119120 | ||
Organism | Escherichia coli strain GENOMIC22-004 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | PYZ88_RS20140 | Protein ID | WP_000347251.1 |
Coordinates | 4137824..4138288 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | PYZ88_RS20135 | Protein ID | WP_001307405.1 |
Coordinates | 4137489..4137824 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYZ88_RS20120 (4133274) | 4133274..4134044 | - | 771 | WP_001058214.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
PYZ88_RS20125 (4134060) | 4134060..4135394 | - | 1335 | WP_000599652.1 | galactarate/glucarate/glycerate transporter GarP | - |
PYZ88_RS20130 (4135769) | 4135769..4137340 | + | 1572 | WP_001273761.1 | galactarate dehydratase | - |
PYZ88_RS20135 (4137489) | 4137489..4137824 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PYZ88_RS20140 (4137824) | 4137824..4138288 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PYZ88_RS20145 (4138343) | 4138343..4139152 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
PYZ88_RS20150 (4139401) | 4139401..4140681 | + | 1281 | WP_000681903.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PYZ88_RS20155 (4140704) | 4140704..4141177 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PYZ88_RS20160 (4141188) | 4141188..4141967 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PYZ88_RS20165 (4141957) | 4141957..4142835 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PYZ88_RS20170 (4142853) | 4142853..4143287 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4126614..4138288 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T273795 WP_000347251.1 NZ_CP119120:4137824-4138288 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |