Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 4023279..4023972 | Replicon | chromosome |
| Accession | NZ_CP119120 | ||
| Organism | Escherichia coli strain GENOMIC22-004 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | U9ZN09 |
| Locus tag | PYZ88_RS19585 | Protein ID | WP_000415585.1 |
| Coordinates | 4023676..4023972 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | PYZ88_RS19580 | Protein ID | WP_000650107.1 |
| Coordinates | 4023279..4023674 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYZ88_RS19570 (4019143) | 4019143..4021401 | - | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
| PYZ88_RS19575 (4021539) | 4021539..4023146 | - | 1608 | WP_001375094.1 | ABC transporter substrate-binding protein | - |
| PYZ88_RS19580 (4023279) | 4023279..4023674 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| PYZ88_RS19585 (4023676) | 4023676..4023972 | - | 297 | WP_000415585.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| PYZ88_RS19590 (4024177) | 4024177..4024659 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| PYZ88_RS19595 (4024712) | 4024712..4025104 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| PYZ88_RS19600 (4025256) | 4025256..4025915 | + | 660 | WP_001221502.1 | quorum sensing response regulator transcription factor QseB | - |
| PYZ88_RS19605 (4025912) | 4025912..4027261 | + | 1350 | WP_000673358.1 | quorum sensing histidine kinase QseC | - |
| PYZ88_RS19610 (4027307) | 4027307..4027639 | - | 333 | WP_000914690.1 | DUF2645 family protein | - |
| PYZ88_RS19615 (4027646) | 4027646..4028356 | - | 711 | WP_000834030.1 | hypothetical protein | - |
| PYZ88_RS19620 (4028359) | 4028359..4028838 | - | 480 | WP_000065332.1 | Hcp family type VI secretion system effector | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11261.99 Da Isoelectric Point: 8.9070
>T273794 WP_000415585.1 NZ_CP119120:c4023972-4023676 [Escherichia coli]
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT273794 WP_000650107.1 NZ_CP119120:c4023674-4023279 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|