Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3681287..3682014 | Replicon | chromosome |
Accession | NZ_CP119120 | ||
Organism | Escherichia coli strain GENOMIC22-004 |
Toxin (Protein)
Gene name | higB | Uniprot ID | J7Q991 |
Locus tag | PYZ88_RS17900 | Protein ID | WP_000547564.1 |
Coordinates | 3681703..3682014 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PYZ88_RS17895 | Protein ID | WP_000126294.1 |
Coordinates | 3681287..3681706 (-) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYZ88_RS17875 (3676337) | 3676337..3676864 | - | 528 | WP_001078777.1 | electron transport protein HydN | - |
PYZ88_RS17880 (3677013) | 3677013..3678023 | - | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
PYZ88_RS17885 (3678283) | 3678283..3679740 | + | 1458 | WP_001107861.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
PYZ88_RS17890 (3679749) | 3679749..3681173 | + | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
PYZ88_RS17895 (3681287) | 3681287..3681706 | - | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
PYZ88_RS17900 (3681703) | 3681703..3682014 | - | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
PYZ88_RS17905 (3682188) | 3682188..3682949 | - | 762 | WP_001026446.1 | hypothetical protein | - |
PYZ88_RS17910 (3682974) | 3682974..3683444 | - | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
PYZ88_RS17915 (3683437) | 3683437..3683847 | - | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
PYZ88_RS17920 (3683844) | 3683844..3684611 | - | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
PYZ88_RS17925 (3684611) | 3684611..3685153 | - | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
PYZ88_RS17930 (3685163) | 3685163..3686872 | - | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T273791 WP_000547564.1 NZ_CP119120:c3682014-3681703 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT273791 WP_000126294.1 NZ_CP119120:c3681706-3681287 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|