Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2599336..2599520 | Replicon | chromosome |
Accession | NZ_CP119113 | ||
Organism | Staphylococcus aureus strain GENOMIC22-002 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | PXV46_RS13095 | Protein ID | WP_000482647.1 |
Coordinates | 2599413..2599520 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2599336..2599396 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXV46_RS13080 (PXV46_13080) | 2594791..2594958 | - | 168 | WP_001798790.1 | hypothetical protein | - |
PXV46_RS13085 (PXV46_13085) | 2595189..2596922 | - | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein | - |
PXV46_RS13090 (PXV46_13090) | 2596947..2598710 | - | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein | - |
- | 2599336..2599396 | + | 61 | - | - | Antitoxin |
PXV46_RS13095 (PXV46_13095) | 2599413..2599520 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
PXV46_RS13100 (PXV46_13100) | 2599654..2600040 | - | 387 | WP_000779355.1 | flippase GtxA | - |
PXV46_RS13105 (PXV46_13105) | 2600307..2601449 | + | 1143 | WP_001176859.1 | glycerate kinase | - |
PXV46_RS13110 (PXV46_13110) | 2601509..2602168 | + | 660 | WP_000831300.1 | hypothetical protein | - |
PXV46_RS13115 (PXV46_13115) | 2602356..2603567 | + | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
PXV46_RS13120 (PXV46_13120) | 2603690..2604163 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T273779 WP_000482647.1 NZ_CP119113:c2599520-2599413 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT273779 NZ_CP119113:2599336-2599396 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|