Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) SprG3-SprA2AS/-
Location 2303536..2303734 Replicon chromosome
Accession NZ_CP119113
Organism Staphylococcus aureus strain GENOMIC22-002

Toxin (Protein)


Gene name SprG3 Uniprot ID Q2FWA7
Locus tag PXV46_RS11540 Protein ID WP_001802298.1
Coordinates 2303630..2303734 (-) Length 35 a.a.

Antitoxin (RNA)


Gene name SprA2AS
Locus tag -
Coordinates 2303536..2303574 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXV46_RS11515 (PXV46_11515) 2299656..2300321 - 666 WP_001024099.1 SDR family oxidoreductase -
PXV46_RS11520 (PXV46_11520) 2300473..2300793 + 321 WP_000003759.1 Zn(II)-responsive metalloregulatory transcriptional repressor CzrA -
PXV46_RS11525 (PXV46_11525) 2300795..2301775 + 981 WP_000019735.1 CDF family zinc efflux transporter CzrB -
PXV46_RS11530 (PXV46_11530) 2302041..2303132 + 1092 WP_000495673.1 hypothetical protein -
PXV46_RS11535 (PXV46_11535) 2303516..2303590 + 75 Protein_2233 hypothetical protein -
- 2303536..2303574 + 39 - - Antitoxin
PXV46_RS11540 (PXV46_11540) 2303630..2303734 - 105 WP_001802298.1 hypothetical protein Toxin
PXV46_RS11545 (PXV46_11545) 2304251..2304421 + 171 WP_001807897.1 hypothetical protein -
PXV46_RS11550 (PXV46_11550) 2304414..2304572 + 159 WP_001792784.1 hypothetical protein -
PXV46_RS11555 (PXV46_11555) 2305008..2305100 + 93 WP_000220902.1 hypothetical protein -
PXV46_RS11560 (PXV46_11560) 2305230..2306087 - 858 WP_000370942.1 HAD family hydrolase -
PXV46_RS11565 (PXV46_11565) 2306155..2306937 - 783 WP_000908191.1 ABC transporter ATP-binding protein -
PXV46_RS11570 (PXV46_11570) 2307227..2307835 - 609 WP_000101714.1 TIR domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 35 a.a.        Molecular weight: 3906.77 Da        Isoelectric Point: 5.5724

>T273778 WP_001802298.1 NZ_CP119113:c2303734-2303630 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK

Download         Length: 105 bp

Antitoxin


Download         Length: 39 bp

>AT273778 NZ_CP119113:2303536-2303574 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y9L9

Antitoxin

Download structure file

References