Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
Location | 2303536..2303734 | Replicon | chromosome |
Accession | NZ_CP119113 | ||
Organism | Staphylococcus aureus strain GENOMIC22-002 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | PXV46_RS11540 | Protein ID | WP_001802298.1 |
Coordinates | 2303630..2303734 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2303536..2303574 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXV46_RS11515 (PXV46_11515) | 2299656..2300321 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
PXV46_RS11520 (PXV46_11520) | 2300473..2300793 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
PXV46_RS11525 (PXV46_11525) | 2300795..2301775 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
PXV46_RS11530 (PXV46_11530) | 2302041..2303132 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
PXV46_RS11535 (PXV46_11535) | 2303516..2303590 | + | 75 | Protein_2233 | hypothetical protein | - |
- | 2303536..2303574 | + | 39 | - | - | Antitoxin |
PXV46_RS11540 (PXV46_11540) | 2303630..2303734 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
PXV46_RS11545 (PXV46_11545) | 2304251..2304421 | + | 171 | WP_001807897.1 | hypothetical protein | - |
PXV46_RS11550 (PXV46_11550) | 2304414..2304572 | + | 159 | WP_001792784.1 | hypothetical protein | - |
PXV46_RS11555 (PXV46_11555) | 2305008..2305100 | + | 93 | WP_000220902.1 | hypothetical protein | - |
PXV46_RS11560 (PXV46_11560) | 2305230..2306087 | - | 858 | WP_000370942.1 | HAD family hydrolase | - |
PXV46_RS11565 (PXV46_11565) | 2306155..2306937 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
PXV46_RS11570 (PXV46_11570) | 2307227..2307835 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T273778 WP_001802298.1 NZ_CP119113:c2303734-2303630 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT273778 NZ_CP119113:2303536-2303574 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|