Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
| Location | 2157696..2157844 | Replicon | chromosome |
| Accession | NZ_CP119113 | ||
| Organism | Staphylococcus aureus strain GENOMIC22-002 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | - |
| Locus tag | PXV46_RS10765 | Protein ID | WP_011276848.1 |
| Coordinates | 2157749..2157844 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2157696..2157731 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXV46_RS10735 (PXV46_10735) | 2153702..2153962 | + | 261 | WP_031863946.1 | persulfide-sensing transcriptional repressor CstR | - |
| PXV46_RS10740 (PXV46_10740) | 2153962..2154717 | + | 756 | WP_031863945.1 | sulfite exporter TauE/SafE family protein | - |
| PXV46_RS10745 (PXV46_10745) | 2155016..2155666 | - | 651 | WP_031903407.1 | NAD(P)-dependent oxidoreductase | - |
| PXV46_RS10750 (PXV46_10750) | 2155851..2156258 | - | 408 | Protein_2081 | DsbA family protein | - |
| PXV46_RS10755 (PXV46_10755) | 2156379..2156807 | - | 429 | WP_031903408.1 | Rrf2 family transcriptional regulator | - |
| PXV46_RS10760 (PXV46_10760) | 2156921..2157412 | - | 492 | Protein_2083 | thymidylate synthase | - |
| - | 2157696..2157731 | - | 36 | - | - | Antitoxin |
| PXV46_RS10765 (PXV46_10765) | 2157749..2157844 | - | 96 | WP_011276848.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| PXV46_RS10770 (PXV46_10770) | 2157996..2158415 | - | 420 | WP_224725316.1 | DUF1700 domain-containing protein | - |
| PXV46_RS10775 (PXV46_10775) | 2158780..2158962 | - | 183 | WP_031903409.1 | hypothetical protein | - |
| PXV46_RS10780 (PXV46_10780) | 2160963..2161931 | - | 969 | WP_031903411.1 | replication initiator protein A | - |
| PXV46_RS10785 (PXV46_10785) | 2162040..2162714 | - | 675 | WP_031920870.1 | IS6 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3623.38 Da Isoelectric Point: 9.5124
>T273775 WP_011276848.1 NZ_CP119113:c2157844-2157749 [Staphylococcus aureus]
MLEILVHITTTVISGCIIALFTHWLRNRKDK
MLEILVHITTTVISGCIIALFTHWLRNRKDK
Download Length: 96 bp
Antitoxin
Download Length: 36 bp
>AT273775 NZ_CP119113:c2157731-2157696 [Staphylococcus aureus]
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
