Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) SprA2-sprA1AS/-
Location 2157696..2157844 Replicon chromosome
Accession NZ_CP119113
Organism Staphylococcus aureus strain GENOMIC22-002

Toxin (Protein)


Gene name SprA2 Uniprot ID -
Locus tag PXV46_RS10765 Protein ID WP_011276848.1
Coordinates 2157749..2157844 (-) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 2157696..2157731 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXV46_RS10735 (PXV46_10735) 2153702..2153962 + 261 WP_031863946.1 persulfide-sensing transcriptional repressor CstR -
PXV46_RS10740 (PXV46_10740) 2153962..2154717 + 756 WP_031863945.1 sulfite exporter TauE/SafE family protein -
PXV46_RS10745 (PXV46_10745) 2155016..2155666 - 651 WP_031903407.1 NAD(P)-dependent oxidoreductase -
PXV46_RS10750 (PXV46_10750) 2155851..2156258 - 408 Protein_2081 DsbA family protein -
PXV46_RS10755 (PXV46_10755) 2156379..2156807 - 429 WP_031903408.1 Rrf2 family transcriptional regulator -
PXV46_RS10760 (PXV46_10760) 2156921..2157412 - 492 Protein_2083 thymidylate synthase -
- 2157696..2157731 - 36 - - Antitoxin
PXV46_RS10765 (PXV46_10765) 2157749..2157844 - 96 WP_011276848.1 type I toxin-antitoxin system Fst family toxin Toxin
PXV46_RS10770 (PXV46_10770) 2157996..2158415 - 420 WP_224725316.1 DUF1700 domain-containing protein -
PXV46_RS10775 (PXV46_10775) 2158780..2158962 - 183 WP_031903409.1 hypothetical protein -
PXV46_RS10780 (PXV46_10780) 2160963..2161931 - 969 WP_031903411.1 replication initiator protein A -
PXV46_RS10785 (PXV46_10785) 2162040..2162714 - 675 WP_031920870.1 IS6 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3623.38 Da        Isoelectric Point: 9.5124

>T273775 WP_011276848.1 NZ_CP119113:c2157844-2157749 [Staphylococcus aureus]
MLEILVHITTTVISGCIIALFTHWLRNRKDK

Download         Length: 96 bp

Antitoxin


Download         Length: 36 bp

>AT273775 NZ_CP119113:c2157731-2157696 [Staphylococcus aureus]
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References