Detailed information of TA system TA273772

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/-
• Location: 939896..940310
• Replicon: chromosome
• Accession: NZ_CP119113
• Organism: Staphylococcus aureus strain GENOMIC22-002

Toxin (Protein)

• Gene name: higB
• Uniprot ID: -
• Locus tag: PXV46_RS04710
• Protein ID: WP_031267622.1
• Coordinates: 939896..940147 (+)
• Length: 84 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: PXV46_RS04715
• Protein ID: WP_000028424.1
• Coordinates: 940137..940310 (+)
• Length: 58 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PXV46_RS04650 (PXV46_04650)	935224..936465	+	1242	WP_001106166.1	DnaB helicase C-terminal domain-containing protein	-
PXV46_RS04655 (PXV46_04655)	936462..936677	+	216	WP_021285875.1	hypothetical protein	-
PXV46_RS04660 (PXV46_04660)	936680..936901	+	222	WP_001123688.1	DUF3269 family protein	-
PXV46_RS04665 (PXV46_04665)	936911..937318	+	408	WP_021285874.1	RusA family crossover junction endodeoxyribonuclease	-
PXV46_RS04670 (PXV46_04670)	937318..937503	+	186	WP_021285873.1	DUF3113 family protein	-
PXV46_RS04675 (PXV46_04675)	937504..938121	+	618	WP_021285872.1	SA1788 family PVL leukocidin-associated protein	-
PXV46_RS04680 (PXV46_04680)	938121..938375	+	255	WP_021285871.1	DUF3310 domain-containing protein	-
PXV46_RS04685 (PXV46_04685)	938375..938623	+	249	WP_078069534.1	SAV1978 family virulence-associated passenger protein	-
PXV46_RS04690 (PXV46_04690)	938638..938844	+	207	WP_021285869.1	hypothetical protein	-
PXV46_RS04695 (PXV46_04695)	938847..939254	+	408	WP_000695770.1	hypothetical protein	-
PXV46_RS04700 (PXV46_04700)	939251..939598	+	348	WP_000979209.1	YopX family protein	-
PXV46_RS04705 (PXV46_04705)	939595..939903	+	309	WP_000144708.1	hypothetical protein	-
PXV46_RS04710 (PXV46_04710)	939896..940147	+	252	WP_031267622.1	DUF1024 family protein	Toxin
PXV46_RS04715 (PXV46_04715)	940137..940310	+	174	WP_000028424.1	hypothetical protein	Antitoxin
PXV46_RS04720 (PXV46_04720)	940311..940472	+	162	WP_000889684.1	hypothetical protein	-
PXV46_RS04725 (PXV46_04725)	940487..940993	+	507	WP_001061842.1	dUTPase	-
PXV46_RS04730 (PXV46_04730)	941030..941236	+	207	WP_021285914.1	DUF1381 domain-containing protein	-
PXV46_RS04735 (PXV46_04735)	941233..941436	+	204	WP_000141180.1	hypothetical protein	-
PXV46_RS04740 (PXV46_04740)	941429..941665	+	237	WP_000608281.1	hypothetical protein	-
PXV46_RS04745 (PXV46_04745)	941655..942044	+	390	WP_169538641.1	hypothetical protein	-
PXV46_RS04750 (PXV46_04750)	942041..942214	+	174	WP_000595258.1	transcriptional activator RinB	-
PXV46_RS04755 (PXV46_04755)	942215..942616	+	402	WP_000286968.1	hypothetical protein	-
PXV46_RS04760 (PXV46_04760)	942964..943344	+	381	WP_031838201.1	DNA-binding protein	-
PXV46_RS04765 (PXV46_04765)	943328..944582	+	1255	Protein_928	PBSX family phage terminase large subunit	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	vWbp	926809..990307	63498

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Protein of unknown function DUF1024 (1-82)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 84 a.a.
• Molecular weight: 9419.35 Da
• Isoelectric Point: 3.9476

>T273772 WP_031267622.1 NZ_CP119113:939896-940147 [Staphylococcus aureus]
MNNREKIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGIELDEAVGIMTGQVVYKYEEEQE
NEY

Nucleotide

• Length: 252 bp

Antitoxin

Protein

• Length: 58 a.a.
• Molecular weight: 6468.29 Da
• Isoelectric Point: 4.2484

>AT273772 WP_000028424.1 NZ_CP119113:940137-940310 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Nucleotide

• Length: 174 bp