273771

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 397412..397826 Replicon chromosome
Accession NZ_CP119113
Organism Staphylococcus aureus strain GENOMIC22-002

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag PXV46_RS01890 Protein ID WP_031267622.1
Coordinates 397412..397663 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PXV46_RS01895 Protein ID WP_000028424.1
Coordinates 397653..397826 (+) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXV46_RS01830 (PXV46_01830) 392741..393982 + 1242 WP_221917899.1 DnaB helicase C-terminal domain-containing protein -
PXV46_RS01835 (PXV46_01835) 393979..394194 + 216 WP_021285875.1 hypothetical protein -
PXV46_RS01840 (PXV46_01840) 394197..394418 + 222 WP_001123688.1 DUF3269 family protein -
PXV46_RS01845 (PXV46_01845) 394428..394835 + 408 WP_021285874.1 RusA family crossover junction endodeoxyribonuclease -
PXV46_RS01850 (PXV46_01850) 394835..395020 + 186 WP_021285873.1 DUF3113 family protein -
PXV46_RS01855 (PXV46_01855) 395021..395638 + 618 WP_021285872.1 SA1788 family PVL leukocidin-associated protein -
PXV46_RS01860 (PXV46_01860) 395638..395892 + 255 WP_021285871.1 DUF3310 domain-containing protein -
PXV46_RS01865 (PXV46_01865) 395892..396140 + 249 WP_078069534.1 SAV1978 family virulence-associated passenger protein -
PXV46_RS01870 (PXV46_01870) 396155..396361 + 207 WP_021285869.1 hypothetical protein -
PXV46_RS01875 (PXV46_01875) 396364..396771 + 408 WP_031903455.1 hypothetical protein -
PXV46_RS01880 (PXV46_01880) 396768..397115 + 348 WP_000979209.1 YopX family protein -
PXV46_RS01885 (PXV46_01885) 397112..397419 + 308 Protein_374 hypothetical protein -
PXV46_RS01890 (PXV46_01890) 397412..397663 + 252 WP_031267622.1 DUF1024 family protein Toxin
PXV46_RS01895 (PXV46_01895) 397653..397826 + 174 WP_000028424.1 hypothetical protein Antitoxin
PXV46_RS01900 (PXV46_01900) 397827..397988 + 162 WP_000889684.1 hypothetical protein -
PXV46_RS01905 (PXV46_01905) 398003..398509 + 507 WP_001061842.1 dUTPase -
PXV46_RS01910 (PXV46_01910) 398546..398752 + 207 WP_031920873.1 DUF1381 domain-containing protein -
PXV46_RS01915 (PXV46_01915) 398749..398901 + 153 WP_031838395.1 transcriptional regulator -
PXV46_RS01920 (PXV46_01920) 398969..399169 + 201 WP_000265258.1 DUF1514 family protein -
PXV46_RS01925 (PXV46_01925) 399340..399804 + 465 Protein_382 hypothetical protein -
PXV46_RS01930 (PXV46_01930) 399913..400011 - 99 WP_001801650.1 hypothetical protein -
PXV46_RS01935 (PXV46_01935) 400145..400435 + 291 WP_000665203.1 VRR-NUC domain-containing protein -
PXV46_RS01940 (PXV46_01940) 400416..401783 + 1368 WP_078099307.1 DEAD/DEAH box helicase -
PXV46_RS01945 (PXV46_01945) 401796..402233 + 438 WP_000513703.1 transcriptional regulator -
PXV46_RS01950 (PXV46_01950) 402390..402704 + 315 WP_000160683.1 HNH endonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 380503..426417 45914


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9419.35 Da        Isoelectric Point: 3.9476

>T273771 WP_031267622.1 NZ_CP119113:397412-397663 [Staphylococcus aureus]
MNNREKIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGIELDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT273771 WP_000028424.1 NZ_CP119113:397653-397826 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References