Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-MW1433/- |
| Location | 882467..882774 | Replicon | chromosome |
| Accession | NZ_CP119109 | ||
| Organism | Staphylococcus aureus strain GENOMIC22-001 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | PXV45_RS04475 | Protein ID | WP_011447039.1 |
| Coordinates | 882467..882643 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | MW1433 | ||
| Locus tag | - | ||
| Coordinates | 882635..882774 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXV45_RS04455 (877702) | 877702..881487 | + | 3786 | WP_000582186.1 | phage tail spike protein | - |
| PXV45_RS04460 (881477) | 881477..881629 | + | 153 | WP_001153681.1 | hypothetical protein | - |
| PXV45_RS04465 (881676) | 881676..881963 | + | 288 | WP_001040261.1 | hypothetical protein | - |
| PXV45_RS04470 (882021) | 882021..882317 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| PXV45_RS04475 (882467) | 882467..882643 | + | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - (882635) | 882635..882774 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (882635) | 882635..882774 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (882635) | 882635..882774 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (882635) | 882635..882774 | - | 140 | NuclAT_0 | - | Antitoxin |
| PXV45_RS04480 (882696) | 882696..882803 | - | 108 | WP_031790389.1 | hypothetical protein | - |
| PXV45_RS04485 (882855) | 882855..883109 | + | 255 | WP_000611512.1 | phage holin | - |
| PXV45_RS04490 (883121) | 883121..883876 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| PXV45_RS04495 (884067) | 884067..884558 | + | 492 | WP_000920041.1 | staphylokinase | - |
| PXV45_RS04500 (885169) | 885169..885519 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| PXV45_RS04505 (885572) | 885572..885832 | - | 261 | WP_001791826.1 | hypothetical protein | - |
| PXV45_RS04510 (886143) | 886143..886322 | - | 180 | WP_000669789.1 | hypothetical protein | - |
| PXV45_RS04515 (886694) | 886694..886891 | - | 198 | WP_000239614.1 | phospholipase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | groEL / hlb / sak / scn | 834078..885519 | 51441 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T273762 WP_011447039.1 NZ_CP119109:882467-882643 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT273762 NZ_CP119109:c882774-882635 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
