Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 411628..411812 | Replicon | chromosome |
| Accession | NZ_CP119109 | ||
| Organism | Staphylococcus aureus strain GENOMIC22-001 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | PXV45_RS01950 | Protein ID | WP_000482647.1 |
| Coordinates | 411628..411735 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 411752..411812 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXV45_RS01925 | 406985..407458 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
| PXV45_RS01930 | 407581..408792 | - | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
| PXV45_RS01935 | 408980..409639 | - | 660 | WP_000831300.1 | hypothetical protein | - |
| PXV45_RS01940 | 409699..410841 | - | 1143 | WP_001176859.1 | glycerate kinase | - |
| PXV45_RS01945 | 411108..411494 | + | 387 | WP_000779355.1 | flippase GtxA | - |
| PXV45_RS01950 | 411628..411735 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 411752..411812 | - | 61 | - | - | Antitoxin |
| PXV45_RS01955 | 412439..414202 | + | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein | - |
| PXV45_RS01960 | 414227..415960 | + | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein | - |
| PXV45_RS01965 | 416191..416358 | + | 168 | WP_001798790.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T273754 WP_000482647.1 NZ_CP119109:411628-411735 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT273754 NZ_CP119109:c411812-411752 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|