Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 2049567..2050157 | Replicon | chromosome |
| Accession | NZ_CP119108 | ||
| Organism | Microbacterium sp. KACC 23027 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | PU630_RS09880 | Protein ID | WP_275276907.1 |
| Coordinates | 2049876..2050157 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PU630_RS09875 | Protein ID | WP_275276906.1 |
| Coordinates | 2049567..2049866 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PU630_RS09850 (PU630_09850) | 2046158..2046604 | + | 447 | WP_275276901.1 | VOC family protein | - |
| PU630_RS09855 (PU630_09855) | 2046667..2047353 | - | 687 | WP_275276902.1 | hypothetical protein | - |
| PU630_RS09860 (PU630_09860) | 2047505..2048266 | - | 762 | WP_275276903.1 | glucose 1-dehydrogenase | - |
| PU630_RS09865 (PU630_09865) | 2048486..2048779 | - | 294 | WP_275276904.1 | hypothetical protein | - |
| PU630_RS09870 (PU630_09870) | 2049113..2049451 | + | 339 | WP_275276905.1 | hypothetical protein | - |
| PU630_RS09875 (PU630_09875) | 2049567..2049866 | - | 300 | WP_275276906.1 | HigA family addiction module antitoxin | Antitoxin |
| PU630_RS09880 (PU630_09880) | 2049876..2050157 | - | 282 | WP_275276907.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PU630_RS09885 (PU630_09885) | 2050198..2050521 | - | 324 | WP_275276908.1 | hypothetical protein | - |
| PU630_RS09890 (PU630_09890) | 2050609..2051682 | - | 1074 | WP_275276909.1 | redox-regulated ATPase YchF | - |
| PU630_RS09895 (PU630_09895) | 2051719..2052423 | - | 705 | WP_275276910.1 | HAD family hydrolase | - |
| PU630_RS09900 (PU630_09900) | 2052420..2053169 | - | 750 | WP_275276911.1 | class I SAM-dependent methyltransferase | - |
| PU630_RS09905 (PU630_09905) | 2053229..2053831 | + | 603 | WP_275276912.1 | exonuclease domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10871.27 Da Isoelectric Point: 8.1098
>T273748 WP_275276907.1 NZ_CP119108:c2050157-2049876 [Microbacterium sp. KACC 23027]
VIRSFGDRDTELVWLREYAKHIDSRIHKAANRKLHLLDAAGTLEALRVPPGNRLEALKGDRRGQHSIRINDQWRICFRWT
EAGPEDVTIEDYH
VIRSFGDRDTELVWLREYAKHIDSRIHKAANRKLHLLDAAGTLEALRVPPGNRLEALKGDRRGQHSIRINDQWRICFRWT
EAGPEDVTIEDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|