Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1847083..1847753 | Replicon | chromosome |
Accession | NZ_CP119108 | ||
Organism | Microbacterium sp. KACC 23027 |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | - |
Locus tag | PU630_RS08875 | Protein ID | WP_275276723.1 |
Coordinates | 1847394..1847753 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | HigA2 | Uniprot ID | - |
Locus tag | PU630_RS08870 | Protein ID | WP_275280061.1 |
Coordinates | 1847083..1847313 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PU630_RS08850 (PU630_08850) | 1844551..1844817 | + | 267 | WP_275276719.1 | hypothetical protein | - |
PU630_RS08855 (PU630_08855) | 1844855..1845967 | + | 1113 | WP_275276720.1 | GNAT family N-acetyltransferase | - |
PU630_RS08860 (PU630_08860) | 1845957..1846634 | - | 678 | WP_275276721.1 | HAD family hydrolase | - |
PU630_RS08865 (PU630_08865) | 1846650..1847051 | - | 402 | WP_275276722.1 | hypothetical protein | - |
PU630_RS08870 (PU630_08870) | 1847083..1847313 | - | 231 | WP_275280061.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PU630_RS08875 (PU630_08875) | 1847394..1847753 | - | 360 | WP_275276723.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PU630_RS08880 (PU630_08880) | 1848564..1849460 | - | 897 | WP_275276724.1 | bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase | - |
PU630_RS08885 (PU630_08885) | 1849462..1850151 | - | 690 | WP_275276725.1 | ribonuclease III | - |
PU630_RS08890 (PU630_08890) | 1850162..1850371 | - | 210 | WP_275276726.1 | 50S ribosomal protein L32 | - |
PU630_RS08895 (PU630_08895) | 1850392..1850949 | - | 558 | WP_275276727.1 | YceD family protein | - |
PU630_RS08900 (PU630_08900) | 1850966..1851463 | - | 498 | WP_275276728.1 | pantetheine-phosphate adenylyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13614.41 Da Isoelectric Point: 5.2427
>T273747 WP_275276723.1 NZ_CP119108:c1847753-1847394 [Microbacterium sp. KACC 23027]
VWEVDLELIEEWLLSLDDASYDQVVAAVELLEEHGPHLGRPLVDAVRASRHKNMKELRPGSSGRSELRVLFAFDPDRQAI
LLVAGDKAGNWKNWYKKNIPVADDLFDVHLRDQKRTKGE
VWEVDLELIEEWLLSLDDASYDQVVAAVELLEEHGPHLGRPLVDAVRASRHKNMKELRPGSSGRSELRVLFAFDPDRQAI
LLVAGDKAGNWKNWYKKNIPVADDLFDVHLRDQKRTKGE
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|