Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1926094..1926722 | Replicon | chromosome |
| Accession | NZ_CP119106 | ||
| Organism | Isoptericola sp. AK164 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | - |
| Locus tag | PO879_RS08930 | Protein ID | WP_278237496.1 |
| Coordinates | 1926405..1926722 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | HigA2 | Uniprot ID | - |
| Locus tag | PO879_RS08925 | Protein ID | WP_278234562.1 |
| Coordinates | 1926094..1926405 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO879_RS08905 | 1921177..1921941 | + | 765 | WP_278234558.1 | anti-sigma factor | - |
| PO879_RS08910 | 1922085..1923125 | + | 1041 | WP_278234559.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| PO879_RS08915 | 1923271..1924914 | + | 1644 | WP_278234560.1 | FAD-dependent oxidoreductase | - |
| PO879_RS08920 | 1925304..1925699 | + | 396 | WP_278234561.1 | VOC family protein | - |
| PO879_RS08925 | 1926094..1926405 | - | 312 | WP_278234562.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PO879_RS08930 | 1926405..1926722 | - | 318 | WP_278237496.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PO879_RS08935 | 1927035..1927556 | - | 522 | WP_278234563.1 | Imm26 family immunity protein | - |
| PO879_RS08945 | 1928217..1929083 | - | 867 | WP_278234564.1 | aminotransferase class IV | - |
| PO879_RS08950 | 1929089..1929700 | - | 612 | WP_278234565.1 | dihydrofolate reductase family protein | - |
| PO879_RS08955 | 1929731..1930861 | - | 1131 | WP_278234566.1 | chorismate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11761.47 Da Isoelectric Point: 9.9977
>T273745 WP_278237496.1 NZ_CP119106:c1926722-1926405 [Isoptericola sp. AK164]
MALDEDSYAQVVAAIELLQQSGPSLGRPLVDTVKASRHKNMKELRPGSSGRSELRVLFAFDPGRRAIMLVAGDKAGNWKR
WYKKSIPEADDLLDTHIRRLKTEGE
MALDEDSYAQVVAAIELLQQSGPSLGRPLVDTVKASRHKNMKELRPGSSGRSELRVLFAFDPGRRAIMLVAGDKAGNWKR
WYKKSIPEADDLLDTHIRRLKTEGE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|