Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 52966..53618 | Replicon | plasmid pK520-TEM |
Accession | NZ_CP118992 | ||
Organism | Aeromonas allosaccharophila strain K520 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A6I4WW70 |
Locus tag | PYU98_RS25810 | Protein ID | WP_024943279.1 |
Coordinates | 52966..53316 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PYU98_RS25815 | Protein ID | WP_024943280.1 |
Coordinates | 53316..53618 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYU98_RS25775 (PYU98_25775) | 48381..49331 | - | 951 | Protein_51 | IS4 family transposase | - |
PYU98_RS25780 (PYU98_25780) | 49330..49977 | + | 648 | WP_270808117.1 | IS5 family transposase | - |
PYU98_RS25785 (PYU98_25785) | 49971..50327 | - | 357 | WP_270808119.1 | hypothetical protein | - |
PYU98_RS25790 (PYU98_25790) | 50504..51205 | + | 702 | WP_182928087.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
PYU98_RS25795 (PYU98_25795) | 51372..51569 | + | 198 | WP_275058444.1 | hypothetical protein | - |
PYU98_RS25800 (PYU98_25800) | 51604..52521 | + | 918 | WP_270808123.1 | IS5 family transposase | - |
PYU98_RS25805 (PYU98_25805) | 52662..52907 | + | 246 | WP_024943278.1 | hypothetical protein | - |
PYU98_RS25810 (PYU98_25810) | 52966..53316 | + | 351 | WP_024943279.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PYU98_RS25815 (PYU98_25815) | 53316..53618 | + | 303 | WP_024943280.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PYU98_RS25820 (PYU98_25820) | 53711..54115 | - | 405 | WP_270808127.1 | IS200/IS605 family transposase | - |
PYU98_RS25825 (PYU98_25825) | 54172..54849 | + | 678 | WP_275058445.1 | transposase | - |
PYU98_RS25830 (PYU98_25830) | 54872..57904 | - | 3033 | WP_039272567.1 | Tn3 family transposase | - |
PYU98_RS25835 (PYU98_25835) | 57901..58494 | - | 594 | WP_039272634.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaTEM-1C | - | 1..73881 | 73881 | |
- | inside | IScluster/Tn | blaTEM-1C | - | 33161..71358 | 38197 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12937.79 Da Isoelectric Point: 5.7350
>T273703 WP_024943279.1 NZ_CP118992:52966-53316 [Aeromonas allosaccharophila]
MWTVKTTSLFDVWFDEQDEATQEKVLAGLLALAQGGPSVGRPLVDTIKGSRFTNLKELRVQHQGDPLRAFFAFDPLRQAI
VLCAGNKGGNDKRFYKEMLPVAEAEYAKHLTELEVG
MWTVKTTSLFDVWFDEQDEATQEKVLAGLLALAQGGPSVGRPLVDTIKGSRFTNLKELRVQHQGDPLRAFFAFDPLRQAI
VLCAGNKGGNDKRFYKEMLPVAEAEYAKHLTELEVG
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|