Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | holin-SprF1/- |
| Location | 1754764..1755134 | Replicon | chromosome |
| Accession | NZ_CP118982 | ||
| Organism | Staphylococcus equorum strain DSM 20674 | ||
Toxin (Protein)
| Gene name | holin | Uniprot ID | A0A1E5TGW5 |
| Locus tag | PYW44_RS08460 | Protein ID | WP_021338679.1 |
| Coordinates | 1754764..1754985 (-) | Length | 74 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 1755036..1755134 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYW44_RS08435 | 1750136..1750693 | + | 558 | WP_021338684.1 | GNAT family protein | - |
| PYW44_RS08440 | 1750755..1752638 | - | 1884 | WP_069812506.1 | glycosyltransferase family 2 protein | - |
| PYW44_RS08445 | 1752945..1753649 | - | 705 | WP_256092540.1 | glycerophosphodiester phosphodiesterase family protein | - |
| PYW44_RS08450 | 1754087..1754194 | - | 108 | WP_021338681.1 | putative holin-like toxin | - |
| PYW44_RS08455 | 1754493..1754609 | - | 117 | WP_165349553.1 | putative holin-like toxin | - |
| PYW44_RS08460 | 1754764..1754985 | - | 222 | WP_021338679.1 | phage holin | Toxin |
| - | 1755036..1755134 | + | 99 | - | - | Antitoxin |
| PYW44_RS08470 | 1755823..1756332 | - | 510 | WP_002507954.1 | metallophosphoesterase | - |
| PYW44_RS08475 | 1756332..1756913 | - | 582 | WP_069812512.1 | XTP/dITP diphosphatase | - |
| PYW44_RS08480 | 1756931..1757725 | - | 795 | WP_002507956.1 | glutamate racemase | - |
| PYW44_RS08485 | 1758001..1758822 | - | 822 | WP_002507957.1 | succinate dehydrogenase iron-sulfur subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 74 a.a. Molecular weight: 8279.78 Da Isoelectric Point: 4.8018
>T273695 WP_021338679.1 NZ_CP118982:c1754985-1754764 [Staphylococcus equorum]
MDVKVTVIVRVLSLILVLVNQWLSNKEVSPIPVDESTLMTIAVALITMWKDNPFTDAAKGSFFKSYTYQLEIF
MDVKVTVIVRVLSLILVLVNQWLSNKEVSPIPVDESTLMTIAVALITMWKDNPFTDAAKGSFFKSYTYQLEIF
Download Length: 222 bp
Antitoxin
Download Length: 99 bp
>AT273695 NZ_CP118982:1755036-1755134 [Staphylococcus equorum]
ATTTGATAATATTTATATGTTGTGTTAATTTATATATAGAAAAAGGGCAACACACCATACGTGTATCGCCCCAATGAGCC
CGTTAAAAAGACGGTGGCT
ATTTGATAATATTTATATGTTGTGTTAATTTATATATAGAAAAAGGGCAACACACCATACGTGTATCGCCCCAATGAGCC
CGTTAAAAAGACGGTGGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|