Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 977331..977590 | Replicon | chromosome |
| Accession | NZ_CP118982 | ||
| Organism | Staphylococcus equorum strain DSM 20674 | ||
Toxin (Protein)
| Gene name | SprG2 | Uniprot ID | - |
| Locus tag | PYW44_RS04635 | Protein ID | WP_002511402.1 |
| Coordinates | 977331..977438 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 977428..977590 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYW44_RS04605 | 972563..973435 | + | 873 | WP_002507156.1 | ABC transporter ATP-binding protein | - |
| PYW44_RS04610 | 973435..974163 | + | 729 | WP_002507157.1 | ABC transporter permease subunit | - |
| PYW44_RS04615 | 974246..974806 | - | 561 | WP_002507158.1 | thioredoxin family protein | - |
| PYW44_RS04620 | 975022..975462 | + | 441 | WP_231111012.1 | hypothetical protein | - |
| PYW44_RS04625 | 975542..976117 | + | 576 | WP_002507160.1 | DUF1700 domain-containing protein | - |
| PYW44_RS04630 | 976114..976965 | + | 852 | WP_021339982.1 | DUF4097 family beta strand repeat-containing protein | - |
| PYW44_RS04635 | 977331..977438 | + | 108 | WP_002511402.1 | putative holin-like toxin | Toxin |
| - | 977428..977590 | - | 163 | - | - | Antitoxin |
| PYW44_RS04640 | 977726..977896 | - | 171 | WP_021339983.1 | tyrosine-type recombinase/integrase | - |
| PYW44_RS04645 | 978204..979244 | - | 1041 | WP_021339984.1 | C45 family autoproteolytic acyltransferase/hydolase | - |
| PYW44_RS04650 | 979739..979909 | + | 171 | WP_002507168.1 | hypothetical protein | - |
| PYW44_RS04655 | 980534..980944 | - | 411 | WP_002507169.1 | YolD-like family protein | - |
| PYW44_RS04660 | 981121..982158 | + | 1038 | WP_021339833.1 | lactonase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3756.72 Da Isoelectric Point: 10.4997
>T273693 WP_002511402.1 NZ_CP118982:977331-977438 [Staphylococcus equorum]
VVPIVEALHLMLGFGTFIVTLLGLVVAIVKLSHKK
VVPIVEALHLMLGFGTFIVTLLGLVVAIVKLSHKK
Download Length: 108 bp
Antitoxin
Download Length: 163 bp
>AT273693 NZ_CP118982:c977590-977428 [Staphylococcus equorum]
ATTTGATAATATTTTTATGTTGTGGTAATTTATATATAGAAAAAGGGCAACACACCATAAGTGTATCGCCCTAATGAGCC
CGTTAAAAAGACGGTGGCTGGAATTTAATAATGATTAAATAATCATCTCATCCTCGCCAAAGTTAGAGATGGTTATTTTT
TAT
ATTTGATAATATTTTTATGTTGTGGTAATTTATATATAGAAAAAGGGCAACACACCATAAGTGTATCGCCCTAATGAGCC
CGTTAAAAAGACGGTGGCTGGAATTTAATAATGATTAAATAATCATCTCATCCTCGCCAAAGTTAGAGATGGTTATTTTT
TAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|