Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1616..2267 | Replicon | plasmid unnamed1 |
Accession | NZ_CP118964 | ||
Organism | Acinetobacter lwoffii strain DSM 2403 |
Toxin (Protein)
Gene name | higB | Uniprot ID | N9NM16 |
Locus tag | PYW33_RS15215 | Protein ID | WP_004668307.1 |
Coordinates | 1616..1972 (+) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PYW33_RS15220 | Protein ID | WP_001140620.1 |
Coordinates | 1965..2267 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYW33_RS15210 | 1..978 | - | 978 | WP_004761028.1 | TerC family protein | - |
PYW33_RS15215 | 1616..1972 | + | 357 | WP_004668307.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PYW33_RS15220 | 1965..2267 | + | 303 | WP_001140620.1 | XRE family transcriptional regulator | Antitoxin |
PYW33_RS15225 | 2309..2470 | - | 162 | Protein_3 | IS6 family transposase | - |
PYW33_RS15230 | 2564..2956 | - | 393 | WP_000550240.1 | Cd(II)/Pb(II)-responsive transcriptional regulator | - |
PYW33_RS15235 | 3046..4326 | + | 1281 | WP_004897603.1 | cation transporter | - |
PYW33_RS15240 | 4453..4923 | - | 471 | Protein_6 | IS3 family transposase | - |
PYW33_RS15245 | 5003..6244 | - | 1242 | WP_004644827.1 | group II intron reverse transcriptase/maturase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..221373 | 221373 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13610.64 Da Isoelectric Point: 7.1651
>T273669 WP_004668307.1 NZ_CP118964:1616-1972 [Acinetobacter lwoffii]
MWTVITTDLFNQWLEQQDEPTQEKVLAALVVLQQQGPSLGRPLVDTVYESKFTNMKELRVQHRGRPLRAFFAFDPLRQAI
VLCIADKGGKKRFYKDMLDIADEQYQLHLTTLGDKSNG
MWTVITTDLFNQWLEQQDEPTQEKVLAALVVLQQQGPSLGRPLVDTVYESKFTNMKELRVQHRGRPLRAFFAFDPLRQAI
VLCIADKGGKKRFYKDMLDIADEQYQLHLTTLGDKSNG
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|