Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2777400..2777736 | Replicon | chromosome |
Accession | NZ_CP118962 | ||
Organism | Enterococcus faecalis strain DSM 20478 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | E2Z0W4 |
Locus tag | PYW42_RS13705 | Protein ID | WP_002381035.1 |
Coordinates | 2777400..2777543 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2777687..2777736 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYW42_RS13685 | 2773492..2774130 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
PYW42_RS13690 | 2774816..2776432 | + | 1617 | WP_002389442.1 | phosphatase PAP2/LCP family protein | - |
PYW42_RS13695 | 2776761..2776910 | + | 150 | WP_002411240.1 | type I toxin-antitoxin system toxin PepG1 | - |
PYW42_RS13700 | 2777029..2777169 | + | 141 | WP_073340360.1 | putative holin-like toxin | - |
PYW42_RS13705 | 2777400..2777543 | + | 144 | WP_002381035.1 | putative holin-like toxin | Toxin |
- | 2777687..2777736 | + | 50 | - | - | Antitoxin |
PYW42_RS13710 | 2777738..2781565 | - | 3828 | WP_010816211.1 | WxL domain-containing protein | - |
PYW42_RS13715 | 2781552..2781914 | - | 363 | WP_002378868.1 | LPXTG cell wall anchor domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5202.20 Da Isoelectric Point: 10.0041
>T273667 WP_002381035.1 NZ_CP118962:2777400-2777543 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT273667 NZ_CP118962:2777687-2777736 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|