Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2776761..2777027 | Replicon | chromosome |
| Accession | NZ_CP118962 | ||
| Organism | Enterococcus faecalis strain DSM 20478 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | PYW42_RS13695 | Protein ID | WP_002411240.1 |
| Coordinates | 2776761..2776910 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2776843..2777027 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYW42_RS13675 | 2771882..2772097 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| PYW42_RS13680 | 2772236..2773228 | + | 993 | WP_002389493.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| PYW42_RS13685 | 2773492..2774130 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
| PYW42_RS13690 | 2774816..2776432 | + | 1617 | WP_002389442.1 | phosphatase PAP2/LCP family protein | - |
| PYW42_RS13695 | 2776761..2776910 | + | 150 | WP_002411240.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - | 2776843..2777027 | - | 185 | - | - | Antitoxin |
| - | 2776843..2777027 | - | 185 | - | - | Antitoxin |
| PYW42_RS13700 | 2777029..2777169 | + | 141 | WP_073340360.1 | putative holin-like toxin | - |
| PYW42_RS13705 | 2777400..2777543 | + | 144 | WP_002381035.1 | putative holin-like toxin | - |
| PYW42_RS13710 | 2777738..2781565 | - | 3828 | WP_010816211.1 | WxL domain-containing protein | - |
| PYW42_RS13715 | 2781552..2781914 | - | 363 | WP_002378868.1 | LPXTG cell wall anchor domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5738.05 Da Isoelectric Point: 11.3858
>T273657 WP_002411240.1 NZ_CP118962:2776761-2776910 [Enterococcus faecalis]
MRMHVFPKFRERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MRMHVFPKFRERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 150 bp
Antitoxin
Download Length: 185 bp
>AT273657 NZ_CP118962:c2777027-2776843 [Enterococcus faecalis]
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCA
ATCAAAGCAATGGTAAACATACCAA
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCA
ATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|