Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2703884..2704146 | Replicon | chromosome |
Accession | NZ_CP118962 | ||
Organism | Enterococcus faecalis strain DSM 20478 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | PYW42_RS13365 | Protein ID | WP_002367458.1 |
Coordinates | 2704003..2704146 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2703884..2704070 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYW42_RS13350 | 2699341..2702085 | + | 2745 | WP_025189146.1 | glycosyl hydrolase family 65 protein | - |
PYW42_RS13355 | 2702100..2702750 | + | 651 | WP_002389419.1 | beta-phosphoglucomutase | - |
PYW42_RS13360 | 2703170..2703763 | + | 594 | WP_002389391.1 | PBECR4 domain-containing protein | - |
- | 2703884..2704070 | + | 187 | - | - | Antitoxin |
PYW42_RS13365 | 2704003..2704146 | - | 144 | WP_002367458.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
PYW42_RS13370 | 2704378..2705349 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
PYW42_RS13375 | 2705524..2705961 | - | 438 | WP_002389480.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
PYW42_RS13380 | 2706094..2706648 | - | 555 | WP_002354869.1 | Maf family protein | - |
PYW42_RS13385 | 2706673..2708805 | - | 2133 | WP_002389406.1 | DNA mismatch repair endonuclease MutL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5311.50 Da Isoelectric Point: 10.8331
>T273654 WP_002367458.1 NZ_CP118962:c2704146-2704003 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 144 bp
Antitoxin
Download Length: 187 bp
>AT273654 NZ_CP118962:2703884-2704070 [Enterococcus faecalis]
TGTGCTAGAATGTAGATGAAAAGAGAGATATGCGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCGATT
GTATTATTTAAAAATAACCGTACTGGTCAAAGTAGATGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGTG
CAATCAAAGCAATGGTAAACATACCAA
TGTGCTAGAATGTAGATGAAAAGAGAGATATGCGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCGATT
GTATTATTTAAAAATAACCGTACTGGTCAAAGTAGATGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGTG
CAATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|