Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3798917..3799569 | Replicon | chromosome |
| Accession | NZ_CP118939 | ||
| Organism | Aeromonas caviae strain K524 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7T3X581 |
| Locus tag | PY772_RS17735 | Protein ID | WP_068982280.1 |
| Coordinates | 3798917..3799267 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PY772_RS17740 | Protein ID | WP_042046566.1 |
| Coordinates | 3799267..3799569 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PY772_RS17705 (PY772_17705) | 3794040..3794444 | + | 405 | WP_102948226.1 | IS200/IS605-like element ISAs26 family transposase | - |
| PY772_RS17710 (PY772_17710) | 3795006..3795431 | - | 426 | WP_010673311.1 | LPP20 family lipoprotein | - |
| PY772_RS17715 (PY772_17715) | 3795520..3796140 | - | 621 | WP_270661226.1 | FlgO family outer membrane protein | - |
| PY772_RS17720 (PY772_17720) | 3796406..3797557 | + | 1152 | WP_039041370.1 | flagellar assembly protein FlgT | - |
| PY772_RS17730 (PY772_17730) | 3797919..3798869 | + | 951 | WP_198497819.1 | DUF932 domain-containing protein | - |
| PY772_RS17735 (PY772_17735) | 3798917..3799267 | + | 351 | WP_068982280.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PY772_RS17740 (PY772_17740) | 3799267..3799569 | + | 303 | WP_042046566.1 | XRE family transcriptional regulator | Antitoxin |
| PY772_RS17745 (PY772_17745) | 3799742..3800731 | + | 990 | WP_198497820.1 | YqaJ viral recombinase family protein | - |
| PY772_RS17750 (PY772_17750) | 3800728..3801684 | + | 957 | WP_198497821.1 | hypothetical protein | - |
| PY772_RS17755 (PY772_17755) | 3801696..3802046 | - | 351 | WP_275058783.1 | helix-turn-helix transcriptional regulator | - |
| PY772_RS17760 (PY772_17760) | 3802254..3802589 | + | 336 | WP_139737641.1 | hypothetical protein | - |
| PY772_RS17765 (PY772_17765) | 3802638..3803087 | + | 450 | WP_198497466.1 | hypothetical protein | - |
| PY772_RS17770 (PY772_17770) | 3803171..3803518 | + | 348 | WP_275058784.1 | YkvA family protein | - |
| PY772_RS17775 (PY772_17775) | 3803538..3803963 | + | 426 | WP_270825732.1 | DUF2787 domain-containing protein | - |
| PY772_RS17780 (PY772_17780) | 3803973..3804383 | + | 411 | WP_270825733.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3792756..3802046 | 9290 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12920.81 Da Isoelectric Point: 6.4664
>T273622 WP_068982280.1 NZ_CP118939:3798917-3799267 [Aeromonas caviae]
MWTVKTTELFDAWFDVQDDATQEKVLAGLLALAQGGPSIGRPLVDTIKGSRFTNLKELRVQHQGEPLRAFFAFDPLRQAI
VLCAGNKGGNEKRFYKEMLPLAEAQYASHLAELEGK
MWTVKTTELFDAWFDVQDDATQEKVLAGLLALAQGGPSIGRPLVDTIKGSRFTNLKELRVQHQGEPLRAFFAFDPLRQAI
VLCAGNKGGNEKRFYKEMLPLAEAQYASHLAELEGK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|