Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 3798917..3799569 Replicon chromosome
Accession NZ_CP118939
Organism Aeromonas caviae strain K524

Toxin (Protein)


Gene name higB Uniprot ID A0A7T3X581
Locus tag PY772_RS17735 Protein ID WP_068982280.1
Coordinates 3798917..3799267 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PY772_RS17740 Protein ID WP_042046566.1
Coordinates 3799267..3799569 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PY772_RS17705 (PY772_17705) 3794040..3794444 + 405 WP_102948226.1 IS200/IS605-like element ISAs26 family transposase -
PY772_RS17710 (PY772_17710) 3795006..3795431 - 426 WP_010673311.1 LPP20 family lipoprotein -
PY772_RS17715 (PY772_17715) 3795520..3796140 - 621 WP_270661226.1 FlgO family outer membrane protein -
PY772_RS17720 (PY772_17720) 3796406..3797557 + 1152 WP_039041370.1 flagellar assembly protein FlgT -
PY772_RS17730 (PY772_17730) 3797919..3798869 + 951 WP_198497819.1 DUF932 domain-containing protein -
PY772_RS17735 (PY772_17735) 3798917..3799267 + 351 WP_068982280.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PY772_RS17740 (PY772_17740) 3799267..3799569 + 303 WP_042046566.1 XRE family transcriptional regulator Antitoxin
PY772_RS17745 (PY772_17745) 3799742..3800731 + 990 WP_198497820.1 YqaJ viral recombinase family protein -
PY772_RS17750 (PY772_17750) 3800728..3801684 + 957 WP_198497821.1 hypothetical protein -
PY772_RS17755 (PY772_17755) 3801696..3802046 - 351 WP_275058783.1 helix-turn-helix transcriptional regulator -
PY772_RS17760 (PY772_17760) 3802254..3802589 + 336 WP_139737641.1 hypothetical protein -
PY772_RS17765 (PY772_17765) 3802638..3803087 + 450 WP_198497466.1 hypothetical protein -
PY772_RS17770 (PY772_17770) 3803171..3803518 + 348 WP_275058784.1 YkvA family protein -
PY772_RS17775 (PY772_17775) 3803538..3803963 + 426 WP_270825732.1 DUF2787 domain-containing protein -
PY772_RS17780 (PY772_17780) 3803973..3804383 + 411 WP_270825733.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3792756..3802046 9290


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(32-81)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12920.81 Da        Isoelectric Point: 6.4664

>T273622 WP_068982280.1 NZ_CP118939:3798917-3799267 [Aeromonas caviae]
MWTVKTTELFDAWFDVQDDATQEKVLAGLLALAQGGPSIGRPLVDTIKGSRFTNLKELRVQHQGEPLRAFFAFDPLRQAI
VLCAGNKGGNEKRFYKEMLPLAEAQYASHLAELEGK

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11179.90 Da        Isoelectric Point: 5.2187

>AT273622 WP_042046566.1 NZ_CP118939:3799267-3799569 [Aeromonas caviae]
MGRTLDDLLASRSEESRQRIQEMATELLLEVRIQALREELEVSQVELAKALGVSQPAVVAMEQRGSDIKLSTMKRYVEAM
GGKLRVDVELPTGRHIGFNV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7T3X581

Antitoxin

Source ID Structure

References