Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 24342..24993 Replicon plasmid pML4_1
Accession NZ_CP118934
Organism Acinetobacter pittii strain ML4

Toxin (Protein)


Gene name higB Uniprot ID A0A7H2WXC0
Locus tag PX335_RS19415 Protein ID WP_006581604.1
Coordinates 24342..24698 (+) Length 119 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PX335_RS19420 Protein ID WP_001140619.1
Coordinates 24691..24993 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PX335_RS19390 (PX335_19385) 19697..20896 + 1200 WP_000059636.1 tyrosine-type recombinase/integrase -
PX335_RS19395 (PX335_19390) 21037..22245 - 1209 WP_275058477.1 IS256-like element ISAba26 family transposase -
PX335_RS19400 (PX335_19395) 22482..22706 + 225 WP_125510319.1 hypothetical protein -
PX335_RS19405 (PX335_19400) 22740..23102 + 363 Protein_24 plasmid replication DNA-binding protein -
PX335_RS19410 (PX335_19405) 23313..23741 - 429 WP_000877730.1 hypothetical protein -
PX335_RS19415 (PX335_19410) 24342..24698 + 357 WP_006581604.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PX335_RS19420 (PX335_19415) 24691..24993 + 303 WP_001140619.1 XRE family transcriptional regulator Antitoxin
PX335_RS19425 (PX335_19420) 24986..25195 + 210 WP_000069471.1 hypothetical protein -
PX335_RS19430 (PX335_19425) 25305..25523 - 219 WP_029747731.1 hypothetical protein -
PX335_RS19440 (PX335_19435) 27388..27564 - 177 WP_228269193.1 AAA family ATPase -
PX335_RS19445 (PX335_19440) 27618..27746 - 129 WP_002123981.1 AAA family ATPase -
PX335_RS19450 (PX335_19445) 27932..28252 + 321 WP_002123990.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
PX335_RS19455 (PX335_19450) 28550..28717 + 168 WP_002072926.1 type II toxin-antitoxin system RelE/ParE family toxin -
PX335_RS19460 (PX335_19455) 28704..28993 + 290 Protein_35 helix-turn-helix domain-containing protein -
PX335_RS19465 (PX335_19460) 29072..29326 - 255 WP_000236586.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..99281 99281
- inside IScluster/Tn - - 21037..27353 6316


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

HigA2-like, helix-turn-helix domain

(13-89)


Sequences

Toxin        


Download         Length: 119 a.a.        Molecular weight: 13462.38 Da        Isoelectric Point: 7.1642

>T273604 WP_006581604.1 NZ_CP118934:24342-24698 [Acinetobacter pittii]
MWTVITTDLFNEWLAQQDQSTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKDLRVQHRGKSLRAFFAFDPLRQAI
VLCIGDKGGKKRFYKEMLDIADQQYEIHLSTLGDQSNG

Download         Length: 357 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11206.01 Da        Isoelectric Point: 6.7282

>AT273604 WP_001140619.1 NZ_CP118934:24691-24993 [Acinetobacter pittii]
MAKTLQELLANRSPESQARIQQMADELLLETQLHLIREELEISQKELAATLGIKQPSLSAIENRGHDLKISTMKKYVEAM
GGKLRIDVELPTGKHIGFNV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7H2WXC0

Antitoxin

Source ID Structure

References