Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4083583..4084235 | Replicon | chromosome |
Accession | NZ_CP118932 | ||
Organism | Serratia marcescens strain RX11 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PXW05_RS19545 | Protein ID | WP_004931830.1 |
Coordinates | 4083583..4083927 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A086GAN0 |
Locus tag | PXW05_RS19550 | Protein ID | WP_004931828.1 |
Coordinates | 4083933..4084235 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXW05_RS19535 (PXW05_19535) | 4079925..4082183 | - | 2259 | WP_275095132.1 | molybdopterin guanine dinucleotide-containing S/N-oxide reductase | - |
PXW05_RS19540 (PXW05_19540) | 4082404..4083423 | + | 1020 | WP_004931832.1 | HTH-type transcriptional regulator GalR | - |
PXW05_RS19545 (PXW05_19545) | 4083583..4083927 | + | 345 | WP_004931830.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PXW05_RS19550 (PXW05_19550) | 4083933..4084235 | + | 303 | WP_004931828.1 | XRE family transcriptional regulator | Antitoxin |
PXW05_RS19555 (PXW05_19555) | 4084263..4085525 | - | 1263 | WP_265261390.1 | diaminopimelate decarboxylase | - |
PXW05_RS19560 (PXW05_19560) | 4085659..4086582 | + | 924 | WP_275095133.1 | LysR family transcriptional regulator | - |
PXW05_RS19565 (PXW05_19565) | 4086610..4087518 | - | 909 | WP_015378928.1 | LysR family transcriptional regulator | - |
PXW05_RS19570 (PXW05_19570) | 4087627..4088511 | + | 885 | WP_004931820.1 | MBL fold metallo-hydrolase | - |
PXW05_RS19575 (PXW05_19575) | 4088586..4089233 | + | 648 | WP_004931818.1 | DsbA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13383.44 Da Isoelectric Point: 10.6087
>T273600 WP_004931830.1 NZ_CP118932:4083583-4083927 [Serratia marcescens]
MWQVVTVERFDDWFLALNNAQQTSILAAIYKLQTFGPQLARPHADTLHFSDAVRQLKELRIQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
MWQVVTVERFDDWFLALNNAQQTSILAAIYKLQTFGPQLARPHADTLHFSDAVRQLKELRIQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|