Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3351499..3352159 | Replicon | chromosome |
| Accession | NZ_CP118932 | ||
| Organism | Serratia marcescens strain RX11 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PXW05_RS16130 | Protein ID | WP_015378478.1 |
| Coordinates | 3351806..3352159 (-) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A6G8TPX9 |
| Locus tag | PXW05_RS16125 | Protein ID | WP_004935502.1 |
| Coordinates | 3351499..3351801 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXW05_RS16100 (PXW05_16100) | 3347052..3347780 | - | 729 | WP_261803215.1 | SDR family oxidoreductase | - |
| PXW05_RS16105 (PXW05_16105) | 3347823..3348458 | - | 636 | WP_015378474.1 | SDR family oxidoreductase | - |
| PXW05_RS16110 (PXW05_16110) | 3348474..3349409 | - | 936 | WP_275094975.1 | alpha/beta hydrolase | - |
| PXW05_RS16115 (PXW05_16115) | 3349409..3350329 | - | 921 | WP_275094976.1 | alpha/beta hydrolase | - |
| PXW05_RS16120 (PXW05_16120) | 3350468..3351376 | + | 909 | WP_004935498.1 | LysR family transcriptional regulator | - |
| PXW05_RS16125 (PXW05_16125) | 3351499..3351801 | - | 303 | WP_004935502.1 | XRE family transcriptional regulator | Antitoxin |
| PXW05_RS16130 (PXW05_16130) | 3351806..3352159 | - | 354 | WP_015378478.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PXW05_RS16135 (PXW05_16135) | 3352598..3353893 | + | 1296 | WP_004935508.1 | MFS transporter | - |
| PXW05_RS16140 (PXW05_16140) | 3353920..3354726 | + | 807 | WP_275094977.1 | substrate-binding domain-containing protein | - |
| PXW05_RS16145 (PXW05_16145) | 3354701..3355600 | - | 900 | WP_275094978.1 | LysR family transcriptional regulator | - |
| PXW05_RS16150 (PXW05_16150) | 3355693..3356058 | - | 366 | WP_004935528.1 | diacylglycerol kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3345483..3372665 | 27182 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13595.58 Da Isoelectric Point: 9.0493
>T273598 WP_015378478.1 NZ_CP118932:c3352159-3351806 [Serratia marcescens]
VWEIKTTDAFDHWFRSLSDADRACVLAALMVLREKGPGLPRPYADTVKGSRYSNMKELRIQSRGEPLRAFFAFDPYRVGM
VLCAGNKAGDEKRFYDRMLQIADREFTNWLNTLKEKE
VWEIKTTDAFDHWFRSLSDADRACVLAALMVLREKGPGLPRPYADTVKGSRYSNMKELRIQSRGEPLRAFFAFDPYRVGM
VLCAGNKAGDEKRFYDRMLQIADREFTNWLNTLKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|