Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 31433..31686 | Replicon | plasmid pL2395_NDM |
| Accession | NZ_CP118928 | ||
| Organism | Citrobacter koseri strain L2395 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PX343_RS22960 | Protein ID | WP_001312851.1 |
| Coordinates | 31433..31582 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 31627..31686 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PX343_RS22925 (26792) | 26792..27207 | - | 416 | Protein_36 | IS1-like element IS1B family transposase | - |
| PX343_RS22930 (27456) | 27456..27857 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| PX343_RS22935 (27790) | 27790..28047 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| PX343_RS22940 (28140) | 28140..28793 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| PX343_RS22945 (29732) | 29732..30589 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| PX343_RS22950 (30582) | 30582..30656 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| PX343_RS22955 (30901) | 30901..31149 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| PX343_RS22960 (31433) | 31433..31582 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (31627) | 31627..31686 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (31627) | 31627..31686 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (31627) | 31627..31686 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (31627) | 31627..31686 | + | 60 | NuclAT_0 | - | Antitoxin |
| PX343_RS22965 (32281) | 32281..32880 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| PX343_RS22970 (33266) | 33266..33466 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| PX343_RS22975 (33598) | 33598..34158 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| PX343_RS22980 (34213) | 34213..34959 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| PX343_RS22985 (34979) | 34979..35116 | - | 138 | WP_191002463.1 | hypothetical protein | - |
| PX343_RS22990 (35204) | 35204..35908 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| PX343_RS22995 (35962) | 35962..36593 | - | 632 | Protein_50 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA14 / qnrS1 / blaNDM-1 | - | 1..67839 | 67839 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T273581 WP_001312851.1 NZ_CP118928:c31582-31433 [Citrobacter koseri]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT273581 NZ_CP118928:31627-31686 [Citrobacter koseri]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
