Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 165251..165978 | Replicon | plasmid p-T-hvKP-1 |
| Accession | NZ_CP118907 | ||
| Organism | Klebsiella pneumoniae strain T-hvKP | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | PXG78_RS26130 | Protein ID | WP_011251285.1 |
| Coordinates | 165667..165978 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PXG78_RS26125 | Protein ID | WP_011251286.1 |
| Coordinates | 165251..165670 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXG78_RS26105 (PXG78_26105) | 160397..163366 | + | 2970 | WP_004213592.1 | Tn3 family transposase | - |
| PXG78_RS26110 (PXG78_26110) | 163408..163902 | + | 495 | WP_004213594.1 | hypothetical protein | - |
| PXG78_RS26115 (PXG78_26115) | 163963..164076 | + | 114 | Protein_171 | Hha/YmoA family nucleoid-associated regulatory protein | - |
| PXG78_RS26120 (PXG78_26120) | 164136..165104 | - | 969 | WP_011251287.1 | IS5 family transposase | - |
| PXG78_RS26125 (PXG78_26125) | 165251..165670 | - | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PXG78_RS26130 (PXG78_26130) | 165667..165978 | - | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PXG78_RS26135 (PXG78_26135) | 166183..166620 | - | 438 | Protein_175 | DDE-type integrase/transposase/recombinase | - |
| PXG78_RS26140 (PXG78_26140) | 166755..167452 | + | 698 | WP_223175001.1 | IS1-like element IS1A family transposase | - |
| PXG78_RS26145 (PXG78_26145) | 167454..167903 | + | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
| PXG78_RS26150 (PXG78_26150) | 167920..168231 | + | 312 | WP_011251282.1 | hypothetical protein | - |
| PXG78_RS26155 (PXG78_26155) | 168245..168586 | + | 342 | WP_011251281.1 | hypothetical protein | - |
| PXG78_RS26160 (PXG78_26160) | 168646..169602 | + | 957 | WP_011251280.1 | DsbA family protein | - |
| PXG78_RS26165 (PXG78_26165) | 169719..170294 | + | 576 | WP_011251279.1 | hypothetical protein | - |
| PXG78_RS26170 (PXG78_26170) | 170402..170917 | + | 516 | WP_041937820.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 / iroB / iroC | 1..224153 | 224153 | |
| - | inside | IScluster/Tn | - | - | 159837..167452 | 7615 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T273562 WP_011251285.1 NZ_CP118907:c165978-165667 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT273562 WP_011251286.1 NZ_CP118907:c165670-165251 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|