Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 327551..328137 | Replicon | chromosome |
| Accession | NZ_CP118906 | ||
| Organism | Klebsiella pneumoniae strain T-hvKP | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A330WAT7 |
| Locus tag | PXG78_RS01525 | Protein ID | WP_014906830.1 |
| Coordinates | 327769..328137 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | PXG78_RS01520 | Protein ID | WP_004174006.1 |
| Coordinates | 327551..327772 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXG78_RS01500 (323708) | 323708..324634 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| PXG78_RS01505 (324631) | 324631..325908 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| PXG78_RS01510 (325905) | 325905..326672 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| PXG78_RS01515 (326674) | 326674..327387 | + | 714 | WP_114501698.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| PXG78_RS01520 (327551) | 327551..327772 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PXG78_RS01525 (327769) | 327769..328137 | + | 369 | WP_014906830.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PXG78_RS01530 (328410) | 328410..329726 | + | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| PXG78_RS01535 (329833) | 329833..330720 | + | 888 | WP_014906831.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| PXG78_RS01540 (330717) | 330717..331562 | + | 846 | WP_004145129.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| PXG78_RS01545 (331564) | 331564..332634 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 324631..333371 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13537.95 Da Isoelectric Point: 8.6410
>T273548 WP_014906830.1 NZ_CP118906:327769-328137 [Klebsiella pneumoniae]
MTLQIISAEEIILFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIILFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A330WAT7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E5YJY7 |