Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 327551..328137 Replicon chromosome
Accession NZ_CP118906
Organism Klebsiella pneumoniae strain T-hvKP

Toxin (Protein)


Gene name doc Uniprot ID A0A330WAT7
Locus tag PXG78_RS01525 Protein ID WP_014906830.1
Coordinates 327769..328137 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag PXG78_RS01520 Protein ID WP_004174006.1
Coordinates 327551..327772 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXG78_RS01500 (323708) 323708..324634 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PXG78_RS01505 (324631) 324631..325908 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
PXG78_RS01510 (325905) 325905..326672 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PXG78_RS01515 (326674) 326674..327387 + 714 WP_114501698.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PXG78_RS01520 (327551) 327551..327772 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PXG78_RS01525 (327769) 327769..328137 + 369 WP_014906830.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PXG78_RS01530 (328410) 328410..329726 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PXG78_RS01535 (329833) 329833..330720 + 888 WP_014906831.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PXG78_RS01540 (330717) 330717..331562 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PXG78_RS01545 (331564) 331564..332634 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 324631..333371 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(28-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13537.95 Da        Isoelectric Point: 8.6410

>T273548 WP_014906830.1 NZ_CP118906:327769-328137 [Klebsiella pneumoniae]
MTLQIISAEEIILFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT273548 WP_004174006.1 NZ_CP118906:327551-327772 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A330WAT7

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References