Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 323760..324346 Replicon chromosome
Accession NZ_CP118901
Organism Klebsiella pneumoniae strain CRKP

Toxin (Protein)


Gene name doc Uniprot ID A0A486RB10
Locus tag PXG74_RS01500 Protein ID WP_004174007.1
Coordinates 323978..324346 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag PXG74_RS01495 Protein ID WP_004174006.1
Coordinates 323760..323981 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXG74_RS01475 (319917) 319917..320843 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PXG74_RS01480 (320840) 320840..322117 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
PXG74_RS01485 (322114) 322114..322881 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PXG74_RS01490 (322883) 322883..323596 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PXG74_RS01495 (323760) 323760..323981 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PXG74_RS01500 (323978) 323978..324346 + 369 WP_004174007.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PXG74_RS01505 (324619) 324619..325935 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PXG74_RS01510 (326042) 326042..326929 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PXG74_RS01515 (326926) 326926..327771 + 846 WP_004174009.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PXG74_RS01520 (327773) 327773..328843 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 320840..329580 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-116)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13568.97 Da        Isoelectric Point: 8.6410

>T273530 WP_004174007.1 NZ_CP118901:323978-324346 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDLGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT273530 WP_004174006.1 NZ_CP118901:323760-323981 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A486RB10

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References