Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 8020..8605 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP118895 | ||
| Organism | Acinetobacter sp. TAC-1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PYV58_RS22815 | Protein ID | WP_180042155.1 |
| Coordinates | 8020..8340 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PYV58_RS22820 | Protein ID | WP_180042153.1 |
| Coordinates | 8333..8605 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYV58_RS22780 (PYV58_22780) | 3600..4136 | - | 537 | WP_265755884.1 | porin family protein | - |
| PYV58_RS22785 (PYV58_22785) | 4537..4824 | + | 288 | WP_275059842.1 | BrnT family toxin | - |
| PYV58_RS22790 (PYV58_22790) | 4811..5125 | + | 315 | WP_275059843.1 | BrnA antitoxin family protein | - |
| PYV58_RS22795 (PYV58_22795) | 5388..5804 | - | 417 | Protein_8 | hypothetical protein | - |
| PYV58_RS22800 (PYV58_22800) | 6002..6799 | - | 798 | WP_086374408.1 | protein phosphatase 2C domain-containing protein | - |
| PYV58_RS22805 (PYV58_22805) | 6861..7223 | - | 363 | WP_275059837.1 | hypothetical protein | - |
| PYV58_RS22810 (PYV58_22810) | 7289..7822 | - | 534 | WP_180042157.1 | hypothetical protein | - |
| PYV58_RS22815 (PYV58_22815) | 8020..8340 | + | 321 | WP_180042155.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PYV58_RS22820 (PYV58_22820) | 8333..8605 | + | 273 | WP_180042153.1 | NadS family protein | Antitoxin |
| PYV58_RS22825 (PYV58_22825) | 9151..9540 | + | 390 | Protein_14 | hypothetical protein | - |
| PYV58_RS22830 (PYV58_22830) | 9592..9885 | + | 294 | WP_227505690.1 | hypothetical protein | - |
| PYV58_RS22835 (PYV58_22835) | 9879..10343 | + | 465 | WP_025464221.1 | hypothetical protein | - |
| PYV58_RS22840 (PYV58_22840) | 10547..11110 | - | 564 | WP_275059838.1 | plasmid replication DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..11749 | 11749 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12181.05 Da Isoelectric Point: 8.8679
>T273529 WP_180042155.1 NZ_CP118895:8020-8340 [Acinetobacter sp. TAC-1]
MLFIETSIFTKQIKELVSDEEYRQLQQDLLLQPDKGDVVKNGGGIRKVRCAQGNKGKSGGIRVIYYWVNEDHQIFFLLAY
PKSVKDTLTDKETAILRQLVKEQLHG
MLFIETSIFTKQIKELVSDEEYRQLQQDLLLQPDKGDVVKNGGGIRKVRCAQGNKGKSGGIRVIYYWVNEDHQIFFLLAY
PKSVKDTLTDKETAILRQLVKEQLHG
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|