Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 3112..3697 | Replicon | plasmid unnamed2 |
Accession | NZ_CP118894 | ||
Organism | Acinetobacter sp. TAC-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V2VZQ9 |
Locus tag | PYV58_RS22685 | Protein ID | WP_000897308.1 |
Coordinates | 3377..3697 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PYV58_RS22680 | Protein ID | WP_000369783.1 |
Coordinates | 3112..3384 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYV58_RS22665 (PYV58_22665) | 1045..1290 | - | 246 | Protein_1 | transcriptional repressor | - |
PYV58_RS22670 (PYV58_22670) | 1274..1861 | - | 588 | WP_051568202.1 | hypothetical protein | - |
PYV58_RS22675 (PYV58_22675) | 1970..2536 | - | 567 | WP_042783562.1 | hypothetical protein | - |
PYV58_RS22680 (PYV58_22680) | 3112..3384 | - | 273 | WP_000369783.1 | NadS family protein | Antitoxin |
PYV58_RS22685 (PYV58_22685) | 3377..3697 | - | 321 | WP_000897308.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PYV58_RS22690 (PYV58_22690) | 3850..4506 | - | 657 | WP_018680109.1 | hypothetical protein | - |
PYV58_RS22695 (PYV58_22695) | 4506..5666 | - | 1161 | WP_018680110.1 | ATP-binding protein | - |
PYV58_RS22700 (PYV58_22700) | 5829..6050 | - | 222 | WP_042783569.1 | hypothetical protein | - |
PYV58_RS22705 (PYV58_22705) | 6047..6403 | - | 357 | WP_042783570.1 | hypothetical protein | - |
PYV58_RS22710 (PYV58_22710) | 6443..7333 | - | 891 | WP_042783571.1 | MobA/MobL family protein | - |
PYV58_RS22715 (PYV58_22715) | 7545..8267 | + | 723 | WP_042783572.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..14301 | 14301 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12193.07 Da Isoelectric Point: 6.9809
>T273527 WP_000897308.1 NZ_CP118894:c3697-3377 [Acinetobacter sp. TAC-1]
MLFIETSIFTKQIKELVSDDEYRELQQELLVQPDKGDLIKNGGGIRKVRCAQGSKGKSGGIRVIYYWITEDDQIFMLLAY
PKSVKENLTDKETAILRQLVKEQFHG
MLFIETSIFTKQIKELVSDDEYRELQQELLVQPDKGDLIKNGGGIRKVRCAQGSKGKSGGIRVIYYWITEDDQIFMLLAY
PKSVKENLTDKETAILRQLVKEQFHG
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|