Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 1960933..1961518 | Replicon | chromosome |
| Accession | NZ_CP118892 | ||
| Organism | Acinetobacter sp. TAC-1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A077KZ82 |
| Locus tag | PYV58_RS09115 | Protein ID | WP_034617593.1 |
| Coordinates | 1960933..1961253 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PYV58_RS09120 | Protein ID | WP_034617591.1 |
| Coordinates | 1961246..1961518 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYV58_RS09100 (PYV58_09100) | 1956257..1957867 | - | 1611 | WP_034617274.1 | pitrilysin family protein | - |
| PYV58_RS09105 (PYV58_09105) | 1957881..1959275 | - | 1395 | WP_034617275.1 | pitrilysin family protein | - |
| PYV58_RS09110 (PYV58_09110) | 1959452..1960558 | + | 1107 | WP_034617276.1 | signal recognition particle-docking protein FtsY | - |
| PYV58_RS09115 (PYV58_09115) | 1960933..1961253 | + | 321 | WP_034617593.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PYV58_RS09120 (PYV58_09120) | 1961246..1961518 | + | 273 | WP_034617591.1 | NadS family protein | Antitoxin |
| PYV58_RS09125 (PYV58_09125) | 1962154..1962747 | + | 594 | WP_034617589.1 | nitroreductase family protein | - |
| PYV58_RS09130 (PYV58_09130) | 1963387..1965549 | + | 2163 | WP_034617586.1 | malate synthase G | - |
| PYV58_RS09135 (PYV58_09135) | 1965740..1966360 | + | 621 | WP_004719624.1 | 2OG-Fe(II) oxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12139.95 Da Isoelectric Point: 8.0125
>T273525 WP_034617593.1 NZ_CP118892:1960933-1961253 [Acinetobacter sp. TAC-1]
MLFIETSIFTKQIKELVTDDEYRQLQQNLLVQPDKGDIVKNGGGIRKVRCAQGDKGKSGGIRVIYYWVSEDDHIFFLVAY
PKSVKDNLTDKETAILRQLVKEQLHG
MLFIETSIFTKQIKELVTDDEYRQLQQNLLVQPDKGDIVKNGGGIRKVRCAQGDKGKSGGIRVIYYWVSEDDHIFFLVAY
PKSVKDNLTDKETAILRQLVKEQLHG
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|