Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 184633..185284 Replicon plasmid p12100-PER
Accession NZ_CP118865
Organism Providencia rettgeri strain 12100

Toxin (Protein)


Gene name higB Uniprot ID A0A857SB97
Locus tag NTP66_RS21320 Protein ID WP_042847389.1
Coordinates 184934..185284 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A8I2DDI8
Locus tag NTP66_RS21315 Protein ID WP_042847390.1
Coordinates 184633..184932 (-) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NTP66_RS21285 180942..181151 + 210 WP_042847397.1 hypothetical protein -
NTP66_RS21290 181228..181542 + 315 WP_042847396.1 hypothetical protein -
NTP66_RS21295 181816..182034 + 219 WP_042847394.1 hypothetical protein -
NTP66_RS21300 182068..182592 + 525 WP_052219403.1 hypothetical protein -
NTP66_RS21305 183024..183458 + 435 WP_282562006.1 hypothetical protein -
NTP66_RS21310 183467..184492 - 1026 WP_282562007.1 hypothetical protein -
NTP66_RS21315 184633..184932 - 300 WP_042847390.1 helix-turn-helix domain-containing protein Antitoxin
NTP66_RS21320 184934..185284 - 351 WP_042847389.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NTP66_RS21325 185469..186032 + 564 WP_042847388.1 recombinase family protein -
NTP66_RS21330 186163..186510 + 348 WP_042847387.1 hypothetical protein -
NTP66_RS21335 186789..187115 + 327 WP_042847386.1 PerC family transcriptional regulator -
NTP66_RS21340 187204..187593 + 390 WP_042847385.1 hypothetical protein -
NTP66_RS21345 187622..188326 + 705 WP_042847384.1 hypothetical protein -
NTP66_RS21350 188341..188880 + 540 WP_042847383.1 hypothetical protein -
NTP66_RS21355 188944..189534 + 591 WP_166268309.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid ant(3'')-Ia / qacE / sul1 / blaPER-1 / mph(A) / rmtB2 - 1..315510 315510
- flank IS/Tn - - 185469..186032 563


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(13-107)

Antitoxin

Cro/C1-type helix-turn-helix domain

(32-84)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13437.50 Da        Isoelectric Point: 5.2661

>T273524 WP_042847389.1 NZ_CP118865:c185284-184934 [Providencia rettgeri]
MWEILTRDLFDSWFEEQNEETQIEVLAVLMILREDGPNLGRPQVDTLKGSQFPNMKELRIQVGGHPIRACFAFDPIRRGI
VLCAGDKKGKDETRFYKKLIKMADAEYAAHLLEQEK

Download         Length: 351 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 10990.70 Da        Isoelectric Point: 7.0171

>AT273524 WP_042847390.1 NZ_CP118865:c184932-184633 [Providencia rettgeri]
MSTLNELLAKQSPETLAKIEDRAEEIRREITLAKIREELKLSQTELAQSLGVSQPSIAKLENVDNDPKLSTLKRYIKALG
GELSIDVTLPNGKRIGLHL

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A857SB97

Antitoxin

Source ID Structure

References