Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 81665..82389 | Replicon | plasmid p12100-PER |
Accession | NZ_CP118865 | ||
Organism | Providencia rettgeri strain 12100 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A8I2DDP5 |
Locus tag | NTP66_RS20810 | Protein ID | WP_042847414.1 |
Coordinates | 82078..82389 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NTP66_RS20805 | Protein ID | WP_042847042.1 |
Coordinates | 81665..82081 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NTP66_RS20780 | 77144..77362 | + | 219 | WP_042847047.1 | hypothetical protein | - |
NTP66_RS20785 | 77486..78478 | + | 993 | WP_282563608.1 | hypothetical protein | - |
NTP66_RS20790 | 78542..79342 | + | 801 | WP_042847045.1 | methyltransferase | - |
NTP66_RS20795 | 79419..80776 | + | 1358 | WP_227528812.1 | IS3 family transposase | - |
NTP66_RS20800 | 80919..81587 | + | 669 | WP_283558198.1 | hypothetical protein | - |
NTP66_RS20805 | 81665..82081 | - | 417 | WP_042847042.1 | helix-turn-helix domain-containing protein | Antitoxin |
NTP66_RS20810 | 82078..82389 | - | 312 | WP_042847414.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
NTP66_RS20815 | 82559..83194 | + | 636 | WP_282561991.1 | hypothetical protein | - |
NTP66_RS20820 | 83586..83864 | + | 279 | WP_162762192.1 | hypothetical protein | - |
NTP66_RS20825 | 84168..85040 | + | 873 | WP_052219406.1 | hypothetical protein | - |
NTP66_RS20830 | 86107..86538 | + | 432 | WP_144138807.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | ant(3'')-Ia / qacE / sul1 / blaPER-1 / mph(A) / rmtB2 | - | 1..315510 | 315510 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12448.21 Da Isoelectric Point: 10.2553
>T273523 WP_042847414.1 NZ_CP118865:c82389-82078 [Providencia rettgeri]
MHVISREPFDQASKRFPNSAQALSDIYRTLKRDSYQTPDELKKVFPSLDRMKYREKWWVIDISGNSLRMMFFADFDRGKI
FVKHITTHAEYDRLTDHYRRTKA
MHVISREPFDQASKRFPNSAQALSDIYRTLKRDSYQTPDELKKVFPSLDRMKYREKWWVIDISGNSLRMMFFADFDRGKI
FVKHITTHAEYDRLTDHYRRTKA
Download Length: 312 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15491.49 Da Isoelectric Point: 4.6438
>AT273523 WP_042847042.1 NZ_CP118865:c82081-81665 [Providencia rettgeri]
MMFQDAVNAAQNLISIVPLLGNSHSREDYEKAVQLVEHLVENDPDNPLIDLICAKIDAYEKTAPEFAEFNERLAKSNGGV
AALRTLMDQYHLNTTDFQDELGSRSYVSRILNGERGLTLEHIKKLSARFNIPASIFID
MMFQDAVNAAQNLISIVPLLGNSHSREDYEKAVQLVEHLVENDPDNPLIDLICAKIDAYEKTAPEFAEFNERLAKSNGGV
AALRTLMDQYHLNTTDFQDELGSRSYVSRILNGERGLTLEHIKKLSARFNIPASIFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|