Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2480092..2480276 | Replicon | chromosome |
Accession | NZ_CP118835 | ||
Organism | Staphylococcus aureus strain 7051 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | PYH51_RS12425 | Protein ID | WP_000482647.1 |
Coordinates | 2480169..2480276 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2480092..2480152 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYH51_RS12410 | 2475543..2475710 | - | 168 | WP_001790576.1 | hypothetical protein | - |
PYH51_RS12415 | 2475941..2477674 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
PYH51_RS12420 | 2477699..2479462 | - | 1764 | WP_006191000.1 | ABC transporter ATP-binding protein | - |
- | 2480092..2480152 | + | 61 | - | - | Antitoxin |
PYH51_RS12425 | 2480169..2480276 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
PYH51_RS12430 | 2480410..2480796 | - | 387 | WP_000779360.1 | flippase GtxA | - |
PYH51_RS12435 | 2481064..2482206 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
PYH51_RS12440 | 2482266..2482925 | + | 660 | WP_000831298.1 | membrane protein | - |
PYH51_RS12445 | 2483107..2484318 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
PYH51_RS12450 | 2484441..2484914 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T273494 WP_000482647.1 NZ_CP118835:c2480276-2480169 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT273494 NZ_CP118835:2480092-2480152 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|