Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2200288..2200504 | Replicon | chromosome |
| Accession | NZ_CP118835 | ||
| Organism | Staphylococcus aureus strain 7051 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | PYH51_RS10955 | Protein ID | WP_001802298.1 |
| Coordinates | 2200400..2200504 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2200288..2200343 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH51_RS10930 | 2196425..2197090 | - | 666 | WP_045177733.1 | SDR family oxidoreductase | - |
| PYH51_RS10935 | 2197242..2197562 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| PYH51_RS10940 | 2197564..2198544 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| PYH51_RS10945 | 2198810..2199901 | + | 1092 | WP_045177732.1 | lytic regulatory protein | - |
| - | 2200288..2200343 | + | 56 | - | - | Antitoxin |
| PYH51_RS10955 | 2200400..2200504 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| PYH51_RS10960 | 2201184..2201342 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| PYH51_RS10965 | 2202001..2202858 | - | 858 | WP_045177730.1 | HAD family hydrolase | - |
| PYH51_RS10970 | 2202925..2203707 | - | 783 | WP_045177727.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T273491 WP_001802298.1 NZ_CP118835:c2200504-2200400 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT273491 NZ_CP118835:2200288-2200343 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|