Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1824052..1824234 | Replicon | chromosome |
Accession | NZ_CP118835 | ||
Organism | Staphylococcus aureus strain 7051 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | PYH51_RS08680 | Protein ID | WP_001801861.1 |
Coordinates | 1824052..1824147 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1824175..1824234 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYH51_RS08645 | 1819722..1820348 | + | 627 | WP_045177256.1 | hypothetical protein | - |
PYH51_RS08650 | 1820389..1820730 | + | 342 | WP_045177258.1 | DUF3969 family protein | - |
PYH51_RS08655 | 1820831..1821403 | + | 573 | WP_045177260.1 | hypothetical protein | - |
PYH51_RS08660 | 1821601..1822229 | - | 629 | Protein_1702 | ImmA/IrrE family metallo-endopeptidase | - |
PYH51_RS08665 | 1822532..1822708 | - | 177 | WP_000375477.1 | hypothetical protein | - |
PYH51_RS08670 | 1822719..1823102 | - | 384 | WP_000070811.1 | hypothetical protein | - |
PYH51_RS08675 | 1823706..1823849 | - | 144 | WP_001549059.1 | transposase | - |
PYH51_RS08680 | 1824052..1824147 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1824175..1824234 | - | 60 | - | - | Antitoxin |
PYH51_RS08685 | 1824270..1824371 | + | 102 | WP_001791893.1 | hypothetical protein | - |
PYH51_RS08690 | 1824349..1824525 | - | 177 | Protein_1708 | transposase | - |
PYH51_RS08695 | 1824719..1825096 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1817162..1901183 | 84021 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T273482 WP_001801861.1 NZ_CP118835:1824052-1824147 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT273482 NZ_CP118835:c1824234-1824175 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|