Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2480095..2480279 | Replicon | chromosome |
Accession | NZ_CP118832 | ||
Organism | Staphylococcus aureus strain 7053 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | PYH65_RS12430 | Protein ID | WP_000482647.1 |
Coordinates | 2480172..2480279 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2480095..2480155 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYH65_RS12415 | 2475546..2475713 | - | 168 | WP_001790576.1 | hypothetical protein | - |
PYH65_RS12420 | 2475944..2477677 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
PYH65_RS12425 | 2477702..2479465 | - | 1764 | WP_006191000.1 | ABC transporter ATP-binding protein | - |
- | 2480095..2480155 | + | 61 | - | - | Antitoxin |
PYH65_RS12430 | 2480172..2480279 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
PYH65_RS12435 | 2480413..2480799 | - | 387 | WP_000779360.1 | flippase GtxA | - |
PYH65_RS12440 | 2481067..2482209 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
PYH65_RS12445 | 2482269..2482928 | + | 660 | WP_000831298.1 | membrane protein | - |
PYH65_RS12450 | 2483110..2484321 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
PYH65_RS12455 | 2484444..2484917 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T273479 WP_000482647.1 NZ_CP118832:c2480279-2480172 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT273479 NZ_CP118832:2480095-2480155 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|