Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2200291..2200507 | Replicon | chromosome |
| Accession | NZ_CP118832 | ||
| Organism | Staphylococcus aureus strain 7053 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | PYH65_RS10960 | Protein ID | WP_001802298.1 |
| Coordinates | 2200403..2200507 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2200291..2200346 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH65_RS10935 | 2196428..2197093 | - | 666 | WP_045177733.1 | SDR family oxidoreductase | - |
| PYH65_RS10940 | 2197245..2197565 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| PYH65_RS10945 | 2197567..2198547 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| PYH65_RS10950 | 2198813..2199904 | + | 1092 | WP_045177732.1 | lytic regulatory protein | - |
| - | 2200291..2200346 | + | 56 | - | - | Antitoxin |
| PYH65_RS10960 | 2200403..2200507 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| PYH65_RS10965 | 2201187..2201345 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| PYH65_RS10970 | 2202004..2202861 | - | 858 | WP_045177730.1 | HAD family hydrolase | - |
| PYH65_RS10975 | 2202928..2203710 | - | 783 | WP_045177727.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T273476 WP_001802298.1 NZ_CP118832:c2200507-2200403 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT273476 NZ_CP118832:2200291-2200346 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|