Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 2026550..2026857 | Replicon | chromosome |
| Accession | NZ_CP118832 | ||
| Organism | Staphylococcus aureus strain 7053 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | PYH65_RS09980 | Protein ID | WP_011447039.1 |
| Coordinates | 2026681..2026857 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2026550..2026689 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH65_RS09940 (2022116) | 2022116..2022295 | + | 180 | WP_000669791.1 | hypothetical protein | - |
| PYH65_RS09945 (2022606) | 2022606..2022866 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| PYH65_RS09950 (2022919) | 2022919..2023269 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| PYH65_RS09955 (2023780) | 2023780..2024115 | - | 336 | Protein_1922 | SH3 domain-containing protein | - |
| PYH65_RS09960 (2024766) | 2024766..2025257 | - | 492 | WP_000920038.1 | staphylokinase | - |
| PYH65_RS09965 (2025448) | 2025448..2026203 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| PYH65_RS09970 (2026215) | 2026215..2026469 | - | 255 | WP_000611512.1 | phage holin | - |
| PYH65_RS09975 (2026521) | 2026521..2026628 | + | 108 | WP_031762631.1 | hypothetical protein | - |
| - (2026550) | 2026550..2026689 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2026550) | 2026550..2026689 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2026550) | 2026550..2026689 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2026550) | 2026550..2026689 | + | 140 | NuclAT_0 | - | Antitoxin |
| PYH65_RS09980 (2026681) | 2026681..2026857 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| PYH65_RS09985 (2026966) | 2026966..2027739 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| PYH65_RS09990 (2028112) | 2028112..2028486 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| PYH65_RS09995 (2028542) | 2028542..2028829 | - | 288 | WP_001262621.1 | hypothetical protein | - |
| PYH65_RS10000 (2028875) | 2028875..2029027 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / sak / sea / hlb / groEL | 2022919..2076574 | 53655 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T273470 WP_011447039.1 NZ_CP118832:c2026857-2026681 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT273470 NZ_CP118832:2026550-2026689 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|