Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 1886410..1886824 Replicon chromosome
Accession NZ_CP118832
Organism Staphylococcus aureus strain 7053

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag PYH65_RS09030 Protein ID WP_001826875.1
Coordinates 1886573..1886824 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PYH65_RS09025 Protein ID WP_000028424.1
Coordinates 1886410..1886583 (-) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYH65_RS08975 (1881977) 1881977..1882288 - 312 WP_029550564.1 hypothetical protein -
PYH65_RS08980 (1882906) 1882906..1884105 - 1200 WP_282873172.1 IS110 family transposase -
PYH65_RS08985 (1884357) 1884357..1884599 - 243 Protein_1767 hypothetical protein -
PYH65_RS08990 (1884600) 1884600..1884773 - 174 WP_176325154.1 transcriptional activator RinB -
PYH65_RS08995 (1884776) 1884776..1884976 - 201 WP_001125015.1 hypothetical protein -
PYH65_RS09000 (1884951) 1884951..1885139 - 189 WP_000195817.1 DUF1381 domain-containing protein -
PYH65_RS09005 (1885136) 1885136..1885381 - 246 WP_001282074.1 hypothetical protein -
PYH65_RS09010 (1885418) 1885418..1885951 - 534 WP_001061841.1 dUTPase -
PYH65_RS09015 (1885966) 1885966..1886127 - 162 WP_000889679.1 hypothetical protein -
PYH65_RS09020 (1886128) 1886128..1886409 - 282 WP_000454993.1 hypothetical protein -
PYH65_RS09025 (1886410) 1886410..1886583 - 174 WP_000028424.1 hypothetical protein Antitoxin
PYH65_RS09030 (1886573) 1886573..1886824 - 252 WP_001826875.1 DUF1024 family protein Toxin
PYH65_RS09035 (1886839) 1886839..1887081 - 243 WP_000131389.1 SAV1978 family virulence-associated passenger protein -
PYH65_RS09040 (1887085) 1887085..1887453 - 369 WP_016028254.1 SA1788 family PVL leukocidin-associated protein -
PYH65_RS09045 (1887454) 1887454..1887639 - 186 WP_016028253.1 DUF3113 family protein -
PYH65_RS09050 (1887644) 1887644..1888048 - 405 WP_000049798.1 DUF1064 domain-containing protein -
PYH65_RS09055 (1888059) 1888059..1888280 - 222 WP_001123681.1 DUF3269 family protein -
PYH65_RS09060 (1888294) 1888294..1888452 - 159 WP_000256589.1 hypothetical protein -
PYH65_RS09065 (1888446) 1888446..1889219 - 774 WP_000803028.1 ATP-binding protein -
PYH65_RS09070 (1889229) 1889229..1889999 - 771 WP_000190226.1 conserved phage C-terminal domain-containing protein -
PYH65_RS09075 (1890045) 1890045..1890704 + 660 WP_016028252.1 hypothetical protein -
PYH65_RS09080 (1890814) 1890814..1891485 - 672 WP_016028251.1 putative HNHc nuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - lukD / hlgA 1817162..1901183 84021
- flank IS/Tn - - 1882906..1883979 1073


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9489.40 Da        Isoelectric Point: 3.9476

>T273468 WP_001826875.1 NZ_CP118832:c1886824-1886573 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKARAFDEILEGMTNAIQHSVREGIELDEAIGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT273468 WP_000028424.1 NZ_CP118832:c1886583-1886410 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References