Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 2026551..2026858 | Replicon | chromosome |
| Accession | NZ_CP118830 | ||
| Organism | Staphylococcus aureus strain 7054 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | PYH54_RS09975 | Protein ID | WP_011447039.1 |
| Coordinates | 2026682..2026858 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2026551..2026690 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH54_RS09935 (2022117) | 2022117..2022296 | + | 180 | WP_000669791.1 | hypothetical protein | - |
| PYH54_RS09940 (2022607) | 2022607..2022867 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| PYH54_RS09945 (2022920) | 2022920..2023270 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| PYH54_RS09950 (2023781) | 2023781..2024116 | - | 336 | Protein_1921 | SH3 domain-containing protein | - |
| PYH54_RS09955 (2024767) | 2024767..2025258 | - | 492 | WP_000920038.1 | staphylokinase | - |
| PYH54_RS09960 (2025449) | 2025449..2026204 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| PYH54_RS09965 (2026216) | 2026216..2026470 | - | 255 | WP_000611512.1 | phage holin | - |
| PYH54_RS09970 (2026522) | 2026522..2026629 | + | 108 | WP_031762631.1 | hypothetical protein | - |
| - (2026551) | 2026551..2026690 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2026551) | 2026551..2026690 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2026551) | 2026551..2026690 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2026551) | 2026551..2026690 | + | 140 | NuclAT_0 | - | Antitoxin |
| PYH54_RS09975 (2026682) | 2026682..2026858 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| PYH54_RS09980 (2026967) | 2026967..2027740 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| PYH54_RS09985 (2028113) | 2028113..2028487 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| PYH54_RS09990 (2028543) | 2028543..2028830 | - | 288 | WP_001262621.1 | hypothetical protein | - |
| PYH54_RS09995 (2028876) | 2028876..2029028 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / sak / sea / hlb / groEL | 2022920..2076574 | 53654 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T273455 WP_011447039.1 NZ_CP118830:c2026858-2026682 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT273455 NZ_CP118830:2026551-2026690 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
