Detailed information of TA system TA273453

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/-
• Location: 1886411..1886825
• Replicon: chromosome
• Accession: NZ_CP118830
• Organism: Staphylococcus aureus strain 7054

Toxin (Protein)

• Gene name: higB
• Uniprot ID: -
• Locus tag: PYH54_RS09025
• Protein ID: WP_001826875.1
• Coordinates: 1886574..1886825 (-)
• Length: 84 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: PYH54_RS09020
• Protein ID: WP_000028424.1
• Coordinates: 1886411..1886584 (-)
• Length: 58 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PYH54_RS08965 (1881977)	1881977..1882288	-	312	WP_029550564.1	hypothetical protein	-
PYH54_RS08970 (1882564)	1882564..1882761	-	198	WP_282873173.1	hypothetical protein	-
PYH54_RS08975 (1882907)	1882907..1884106	-	1200	WP_282873172.1	IS110 family transposase	-
PYH54_RS08980 (1884358)	1884358..1884600	-	243	Protein_1766	hypothetical protein	-
PYH54_RS08985 (1884601)	1884601..1884774	-	174	WP_176325154.1	transcriptional activator RinB	-
PYH54_RS08990 (1884777)	1884777..1884977	-	201	WP_001125015.1	hypothetical protein	-
PYH54_RS08995 (1884952)	1884952..1885140	-	189	WP_000195817.1	DUF1381 domain-containing protein	-
PYH54_RS09000 (1885137)	1885137..1885382	-	246	WP_001282074.1	hypothetical protein	-
PYH54_RS09005 (1885419)	1885419..1885952	-	534	WP_001061841.1	dUTPase	-
PYH54_RS09010 (1885967)	1885967..1886128	-	162	WP_000889679.1	hypothetical protein	-
PYH54_RS09015 (1886129)	1886129..1886410	-	282	WP_000454993.1	hypothetical protein	-
PYH54_RS09020 (1886411)	1886411..1886584	-	174	WP_000028424.1	hypothetical protein	Antitoxin
PYH54_RS09025 (1886574)	1886574..1886825	-	252	WP_001826875.1	DUF1024 family protein	Toxin
PYH54_RS09030 (1886840)	1886840..1887082	-	243	WP_000131389.1	SAV1978 family virulence-associated passenger protein	-
PYH54_RS09035 (1887086)	1887086..1887454	-	369	WP_016028254.1	SA1788 family PVL leukocidin-associated protein	-
PYH54_RS09040 (1887455)	1887455..1887640	-	186	WP_016028253.1	DUF3113 family protein	-
PYH54_RS09045 (1887645)	1887645..1888049	-	405	WP_000049798.1	DUF1064 domain-containing protein	-
PYH54_RS09050 (1888060)	1888060..1888281	-	222	WP_001123681.1	DUF3269 family protein	-
PYH54_RS09055 (1888295)	1888295..1888453	-	159	WP_000256589.1	hypothetical protein	-
PYH54_RS09060 (1888447)	1888447..1889220	-	774	WP_000803028.1	ATP-binding protein	-
PYH54_RS09065 (1889230)	1889230..1890000	-	771	WP_000190226.1	conserved phage C-terminal domain-containing protein	-
PYH54_RS09070 (1890046)	1890046..1890705	+	660	WP_016028252.1	hypothetical protein	-
PYH54_RS09075 (1890815)	1890815..1891486	-	672	WP_016028251.1	putative HNHc nuclease	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	lukD / hlgA	1817161..1901184	84023
	-	flank	IS/Tn	-	-	1882907..1883980	1073

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Protein of unknown function DUF1024 (1-82)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 84 a.a.
• Molecular weight: 9489.40 Da
• Isoelectric Point: 3.9476

>T273453 WP_001826875.1 NZ_CP118830:c1886825-1886574 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKARAFDEILEGMTNAIQHSVREGIELDEAIGIMTGQVVYKYEEEQE
NEY

Nucleotide

• Length: 252 bp

Antitoxin

Protein

• Length: 58 a.a.
• Molecular weight: 6468.29 Da
• Isoelectric Point: 4.2484

>AT273453 WP_000028424.1 NZ_CP118830:c1886584-1886411 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Nucleotide

• Length: 174 bp