Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1824051..1824233 | Replicon | chromosome |
| Accession | NZ_CP118830 | ||
| Organism | Staphylococcus aureus strain 7054 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | PYH54_RS08675 | Protein ID | WP_001801861.1 |
| Coordinates | 1824051..1824146 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1824174..1824233 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH54_RS08635 | 1819721..1820347 | + | 627 | WP_045177256.1 | hypothetical protein | - |
| PYH54_RS08640 | 1820388..1820729 | + | 342 | WP_045177258.1 | DUF3969 family protein | - |
| PYH54_RS08645 | 1820830..1821402 | + | 573 | WP_045177260.1 | hypothetical protein | - |
| PYH54_RS08650 | 1821600..1822228 | - | 629 | Protein_1700 | ImmA/IrrE family metallo-endopeptidase | - |
| PYH54_RS08655 | 1822343..1822495 | - | 153 | WP_001217402.1 | hypothetical protein | - |
| PYH54_RS08660 | 1822531..1822707 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| PYH54_RS08665 | 1822718..1823101 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| PYH54_RS08670 | 1823705..1823848 | - | 144 | WP_001549059.1 | transposase | - |
| PYH54_RS08675 | 1824051..1824146 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1824174..1824233 | - | 60 | - | - | Antitoxin |
| PYH54_RS08680 | 1824269..1824370 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| PYH54_RS08685 | 1824348..1824524 | - | 177 | Protein_1707 | transposase | - |
| PYH54_RS08690 | 1824718..1825095 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1817161..1901184 | 84023 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T273452 WP_001801861.1 NZ_CP118830:1824051-1824146 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT273452 NZ_CP118830:c1824233-1824174 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|