Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1824051..1824233 Replicon chromosome
Accession NZ_CP118830
Organism Staphylococcus aureus strain 7054

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag PYH54_RS08675 Protein ID WP_001801861.1
Coordinates 1824051..1824146 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1824174..1824233 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYH54_RS08635 1819721..1820347 + 627 WP_045177256.1 hypothetical protein -
PYH54_RS08640 1820388..1820729 + 342 WP_045177258.1 DUF3969 family protein -
PYH54_RS08645 1820830..1821402 + 573 WP_045177260.1 hypothetical protein -
PYH54_RS08650 1821600..1822228 - 629 Protein_1700 ImmA/IrrE family metallo-endopeptidase -
PYH54_RS08655 1822343..1822495 - 153 WP_001217402.1 hypothetical protein -
PYH54_RS08660 1822531..1822707 - 177 WP_000375477.1 hypothetical protein -
PYH54_RS08665 1822718..1823101 - 384 WP_000070811.1 hypothetical protein -
PYH54_RS08670 1823705..1823848 - 144 WP_001549059.1 transposase -
PYH54_RS08675 1824051..1824146 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1824174..1824233 - 60 - - Antitoxin
PYH54_RS08680 1824269..1824370 + 102 WP_001791893.1 hypothetical protein -
PYH54_RS08685 1824348..1824524 - 177 Protein_1707 transposase -
PYH54_RS08690 1824718..1825095 - 378 WP_001037045.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - lukD / hlgA 1817161..1901184 84023


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T273452 WP_001801861.1 NZ_CP118830:1824051-1824146 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT273452 NZ_CP118830:c1824233-1824174 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References