Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 6543086..6543709 | Replicon | chromosome |
| Accession | NZ_CP118775 | ||
| Organism | Delftia tsuruhatensis strain ULwDis3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PW274_RS30495 | Protein ID | WP_126311616.1 |
| Coordinates | 6543428..6543709 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1I1B5A1 |
| Locus tag | PW274_RS30490 | Protein ID | WP_026062357.1 |
| Coordinates | 6543086..6543385 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PW274_RS30465 (PW274_30465) | 6538378..6539169 | - | 792 | WP_126311619.1 | SDR family oxidoreductase | - |
| PW274_RS30470 (PW274_30470) | 6539263..6540198 | + | 936 | WP_126311618.1 | LysR family transcriptional regulator | - |
| PW274_RS30475 (PW274_30475) | 6540460..6541233 | + | 774 | WP_016448667.1 | ferredoxin--NADP reductase | - |
| PW274_RS30480 (PW274_30480) | 6541278..6542084 | + | 807 | WP_126311617.1 | IclR family transcriptional regulator | - |
| PW274_RS30485 (PW274_30485) | 6542220..6542993 | + | 774 | WP_016448669.1 | SDR family oxidoreductase | - |
| PW274_RS30490 (PW274_30490) | 6543086..6543385 | - | 300 | WP_026062357.1 | HigA family addiction module antitoxin | Antitoxin |
| PW274_RS30495 (PW274_30495) | 6543428..6543709 | - | 282 | WP_126311616.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PW274_RS30500 (PW274_30500) | 6543839..6545014 | - | 1176 | WP_016452145.1 | ABC transporter substrate-binding protein | - |
| PW274_RS30505 (PW274_30505) | 6545070..6545777 | - | 708 | WP_016448672.1 | ABC transporter ATP-binding protein | - |
| PW274_RS30510 (PW274_30510) | 6545764..6546528 | - | 765 | WP_016452146.1 | ABC transporter ATP-binding protein | - |
| PW274_RS30515 (PW274_30515) | 6546515..6547489 | - | 975 | WP_016452147.1 | branched-chain amino acid ABC transporter permease | - |
| PW274_RS30520 (PW274_30520) | 6547490..6548353 | - | 864 | WP_016448674.1 | branched-chain amino acid ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11024.64 Da Isoelectric Point: 10.1059
>T273437 WP_126311616.1 NZ_CP118775:c6543709-6543428 [Delftia tsuruhatensis]
MTIQSFKCPDTEQLFQQRRVRRWSSIEVVALRKLRMLHAAHVLQDLRGPPGNRLEALHGDRKGQHSIRINDQWRVCFVWT
HEGPSQLEIVDYH
MTIQSFKCPDTEQLFQQRRVRRWSSIEVVALRKLRMLHAAHVLQDLRGPPGNRLEALHGDRKGQHSIRINDQWRVCFVWT
HEGPSQLEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|