Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 5958875..5959692 | Replicon | chromosome |
| Accession | NZ_CP118775 | ||
| Organism | Delftia tsuruhatensis strain ULwDis3 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A072THA9 |
| Locus tag | PW274_RS27825 | Protein ID | WP_043790975.1 |
| Coordinates | 5959201..5959692 (+) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | - |
| Locus tag | PW274_RS27820 | Protein ID | WP_016448384.1 |
| Coordinates | 5958875..5959204 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PW274_RS27795 (PW274_27795) | 5954083..5954358 | - | 276 | WP_047327871.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| PW274_RS27800 (PW274_27800) | 5954425..5955258 | - | 834 | WP_126311033.1 | helix-turn-helix transcriptional regulator | - |
| PW274_RS27805 (PW274_27805) | 5955329..5955991 | + | 663 | WP_126311034.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| PW274_RS27810 (PW274_27810) | 5956019..5956414 | + | 396 | WP_126311035.1 | hypothetical protein | - |
| PW274_RS27815 (PW274_27815) | 5956538..5958778 | + | 2241 | WP_126311036.1 | TonB-dependent receptor | - |
| PW274_RS27820 (PW274_27820) | 5958875..5959204 | + | 330 | WP_016448384.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| PW274_RS27825 (PW274_27825) | 5959201..5959692 | + | 492 | WP_043790975.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| PW274_RS27830 (PW274_27830) | 5959707..5960219 | - | 513 | WP_016448386.1 | MgtC/SapB family protein | - |
| PW274_RS27835 (PW274_27835) | 5960334..5961731 | - | 1398 | WP_017406579.1 | chloride channel protein | - |
| PW274_RS27840 (PW274_27840) | 5962006..5962335 | - | 330 | WP_013800515.1 | DHCW motif cupin fold protein | - |
| PW274_RS27845 (PW274_27845) | 5962399..5963196 | - | 798 | WP_126311037.1 | precorrin-6A synthase (deacetylating) | - |
| PW274_RS27850 (PW274_27850) | 5963193..5964071 | - | 879 | WP_126311038.1 | precorrin-4 C(11)-methyltransferase | - |
| PW274_RS27855 (PW274_27855) | 5964068..5964565 | - | 498 | WP_126311039.1 | cobalamin biosynthesis protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 18801.33 Da Isoelectric Point: 9.9304
>T273436 WP_043790975.1 NZ_CP118775:5959201-5959692 [Delftia tsuruhatensis]
MSAVPPAPLRIHGWTVFMHPLFLAQLQALSHEVEGLKTKDPGGYTRKNATKRLAAIRKLAFDVIPQDPTRPDYRQGHTLG
EEHKHWFRARFFQQYRLFFRFHAPSKIIVFAWVNDEDTRRAYEGSDDAYRVFRKMLANGHPPGDWDSLLAQAESPPPDSQ
PHA
MSAVPPAPLRIHGWTVFMHPLFLAQLQALSHEVEGLKTKDPGGYTRKNATKRLAAIRKLAFDVIPQDPTRPDYRQGHTLG
EEHKHWFRARFFQQYRLFFRFHAPSKIIVFAWVNDEDTRRAYEGSDDAYRVFRKMLANGHPPGDWDSLLAQAESPPPDSQ
PHA
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|